DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and CG30495

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001260785.1 Gene:CG30495 / 246651 FlyBaseID:FBgn0050495 Length:331 Species:Drosophila melanogaster


Alignment Length:300 Identity:74/300 - (24%)
Similarity:123/300 - (41%) Gaps:79/300 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 VIVFLLLLPLVLLAVFLKHLLDYLFALGL------KEKDVSGKVALVTGGGSGLGREICLELARR 115
            ||.||..:..|.||..:..::.:...|.:      |:.|.:||||:||||.:|||:|..:|||||
  Fly     4 VIRFLQSIAPVFLAHGIVGIIAFCVRLYMQGGKFRKQTDETGKVAIVTGGNTGLGKETVMELARR 68

  Fly   116 GCKLAVVDVNSKGCYETVELLSKIPRCVAKAYKN--------DVSSPRELQLMAAKVEKELGPVD 172
            |..:.:...|.       |.:.:..|.:.|...|        |:||...::..|...:||...:.
  Fly    69 GATVYMACRNK-------EKVERARREIVKETGNSNVFSRECDLSSLDSIRKFAENFKKEQRVLH 126

  Fly   173 ILVNNASLM--PMTSTPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLV- 234
            ||:|||.:.  |...|..        ..:::||             :|. .||.:..|.|.|:: 
  Fly   127 ILINNAGVFWEPHRLTKE--------GFEMHLG-------------VNH-IGHFLLTNLLLGVLE 169

  Fly   235 -PLPGAGIYTATKYGIEGFMESLRAELRLSDCD----------YVRTTVANAYLMR--------- 279
             ..|...:..|::       ...|.::::.|.:          |.::.:||....|         
  Fly   170 RSAPSRVVVVASR-------AHERGQIKVDDINSSDFYDEGVAYCQSKLANILFTRELAKRLEGT 227

  Fly   280 --TSGDL-PLLSDAGIAKSYPGLPT---PYVAEKIVKGVL 313
              |...| |.::|..||::.....|   .||.|.|::.:|
  Fly   228 GVTVNALNPGIADTEIARNMIFFQTKFAQYVVETILRPLL 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 63/259 (24%)
NADB_Rossmann 94..338 CDD:304358 61/256 (24%)
CG30495NP_001260785.1 FabG 44..296 CDD:223959 63/259 (24%)
NADB_Rossmann 45..323 CDD:304358 63/258 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447571
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.