DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and Sdr16c5

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_871789.1 Gene:Sdr16c5 / 242285 MGIID:2668443 Length:309 Species:Mus musculus


Alignment Length:291 Identity:94/291 - (32%)
Similarity:143/291 - (49%) Gaps:24/291 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 LAVFL-KHLLDYLFAL-----GLKEKDVSGKVALVTGGGSGLGREICLELARRGCKLAVVDVNSK 127
            |.||| |.||..|.||     ....|:|:|::.|:||.||||||.:.|:.||.|..|.:.|||.:
Mouse    11 LLVFLGKSLLSVLEALLFHVISKPRKNVAGEIVLITGAGSGLGRLLALQFARLGAVLVLWDVNKE 75

  Fly   128 GCYETVELLSKIPRCVAKAYKNDVSSPRELQLMAAKVEKELGPVDILVNNASLMPMTSTPSLKSD 192
            ...||.:|..:.......||..|.|...|:..:|.:|:||:|.|.||:|||.::...:......|
Mouse    76 ANDETHQLAREAGAARVHAYTCDCSRREEVYRVADQVKKEVGDVSILINNAGIVTGRNFLDCPDD 140

  Fly   193 EIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKYGIEGFMESLR 257
            .::....:|..:::...|.|||.||....||||.:::.|||:.:.|...|.|:|:...||.||:.
Mouse   141 LMEKSFDVNFKAHLWMYKAFLPAMIANNHGHLVCISSSAGLIGVNGLSDYCASKFAALGFAESMF 205

  Fly   258 AELRLSDCDYVRTTVANAYLMRT------SGDLPLLSDAGIAKSYPGLPTPYVAEKIVKGVLLNE 316
            .|........::||:...:.::|      :...|.|        .|.|...|...||:..:|..:
Mouse   206 IETLAKKQWGIKTTIVCPFFIKTGMFEGCTTKCPTL--------LPILDPEYAVRKIIDAILQEQ 262

  Fly   317 RMVYVPKIFALSVWLLRLLPTKW----QDYM 343
            ..:|:||.....|:|..:||.|.    .||:
Mouse   263 LYLYMPKFLYFIVFLKSILPIKTGILIADYL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 82/263 (31%)
NADB_Rossmann 94..338 CDD:304358 78/249 (31%)
Sdr16c5NP_871789.1 adh_short 41..231 CDD:278532 63/189 (33%)
17beta-HSDXI-like_SDR_c 42..284 CDD:187598 78/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.