DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and SDR16C5

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_001304978.1 Gene:SDR16C5 / 195814 HGNCID:30311 Length:318 Species:Homo sapiens


Alignment Length:294 Identity:90/294 - (30%)
Similarity:145/294 - (49%) Gaps:28/294 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 FNL----KVIVFL-----LLLPLVLLAVFLKHLLDYLFALGLKEKDVSGKVALVTGGGSGLGREI 108
            |||    |:.:||     .||..::.|:..|           ..|:|:|::.|:||.||||||.:
Human     3 FNLQSSKKLFIFLGKSLFSLLEAMIFALLPK-----------PRKNVAGEIVLITGAGSGLGRLL 56

  Fly   109 CLELARRGCKLAVVDVNSKGCYETVELLSKIPRCVAKAYKNDVSSPRELQLMAAKVEKELGPVDI 173
            .|:.||.|..|.:.|:|.:|..||.::..:.......||..|.|....:..:|.:|:||:|.|.|
Human    57 ALQFARLGSVLVLWDINKEGNEETCKMAREAGATRVHAYTCDCSQKEGVYRVADQVKKEVGDVSI 121

  Fly   174 LVNNASLMPMTSTPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPG 238
            |:|||.::..........:.::....:|..:::.|.|.|||.||....||||.:::.|||..:.|
Human   122 LINNAGIVTGKKFLDCPDELMEKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCISSSAGLSGVNG 186

  Fly   239 AGIYTATKYGIEGFMESLRAELRLSDCDYVRTTVANAYLMRT---SGDLPLLSDAGIAKSYPGLP 300
            ...|.|:|:...||.||:..|..:.....::||:...:.::|   .|     ...|.....|.|.
Human   187 LADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKTGMFEG-----CTTGCPSLLPILE 246

  Fly   301 TPYVAEKIVKGVLLNERMVYVPKIFALSVWLLRL 334
            ..|..||||:.:|..:..:|:||:....::|.||
Human   247 PKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKRL 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 78/247 (32%)
NADB_Rossmann 94..338 CDD:304358 77/244 (32%)
SDR16C5NP_001304978.1 adh_short 41..231 CDD:278532 61/189 (32%)
17beta-HSDXI-like_SDR_c 42..280 CDD:187598 75/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.