DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and dhs-4

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_492563.1 Gene:dhs-4 / 172810 WormBaseID:WBGene00000968 Length:305 Species:Caenorhabditis elegans


Alignment Length:300 Identity:88/300 - (29%)
Similarity:157/300 - (52%) Gaps:17/300 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LKVIVFLLLLPLVLLAVFLKHLLDYLFALGLKEKDVSGKVALVTGGGSGLGREICLELARRGCKL 119
            |::::.|..|.:..|...:|:.|.|..   |.:||:..|..|:||.|:|||:.:..:.|.||..|
 Worm     6 LEIVILLFNLLIQNLISLIKYALPYSL---LPKKDLYRKKVLITGAGNGLGKLLAQKFAARGATL 67

  Fly   120 AVVDVNSKGCYETVELLSKI--PRCVAKAYKNDVSSPRELQLMAAKVEKELGPVDILVNNASLMP 182
            .:.|:|.:   ...||.::|  .:..|.:|:.::..|.::..:..:|..::|.||||||||.:..
 Worm    68 ILWDINLQ---SVDELKNEIRGNQGEAHSYEVNLCDPGKIAQVGQQVINDIGKVDILVNNAGIAT 129

  Fly   183 MTSTPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKY 247
            .........:||:....:|:.::..|.::|||.|:...:||:|.:.:.||.:...|...|::||:
 Worm   130 AKMILDSSENEINRSFDVNVKAHFYTVQQFLPAMLKDNNGHIVTIASAAGKMGSSGLADYSSTKH 194

  Fly   248 GIEGFMESLRAELRLSDCDYVRTTVANAYLMRTSGDLPLLSDAGIAKSYPG----LPTPYVAEKI 308
            ...||.:||.||:..|:.:.|:||:...|.:.||    :....|.|..:|.    |.|.||.:||
 Worm   195 AAVGFHDSLVAEIMESEKNGVKTTLVCPYYVHTS----MFDATGAATRFPWIFPILDTDYVVQKI 255

  Fly   309 VKGVLLNERMVYVPKIFALSVWLLRLLPTKWQDYMLLRFY 348
            .:.:...:..:..|:.|.|....:::||.|.| .|:.:|:
 Worm   256 FEAIETEQEFLVTPRAFYLVFAGIQILPYKAQ-AMVAQFF 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 78/263 (30%)
NADB_Rossmann 94..338 CDD:304358 73/249 (29%)
dhs-4NP_492563.1 adh_short 41..235 CDD:278532 60/200 (30%)
17beta-HSDXI-like_SDR_c 43..286 CDD:187598 73/249 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.