DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17121 and Hsd17b11

DIOPT Version :9

Sequence 1:NP_651114.1 Gene:CG17121 / 42721 FlyBaseID:FBgn0039043 Length:361 Species:Drosophila melanogaster
Sequence 2:NP_444492.1 Gene:Hsd17b11 / 114664 MGIID:2149821 Length:298 Species:Mus musculus


Alignment Length:290 Identity:95/290 - (32%)
Similarity:147/290 - (50%) Gaps:18/290 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LKVIVFLLLLPLVLLAVFLKHLLDYLFALGLKEKDVSGKVALVTGGGSGLGREICLELARRGCKL 119
            :|.::.|:|| |.||.||....|..|| :..|:|.|:|::.|:||.|.|:||....|.|:...||
Mouse     1 MKYLLDLILL-LPLLIVFSIESLVKLF-IPKKKKSVAGEIVLITGAGHGIGRLTAYEFAKLNTKL 63

  Fly   120 AVVDVNSKGCYETVELLSKIPRCVAKAYKNDVSSPRELQLMAAKVEKELGPVDILVNNASLMPMT 184
            .:.|:|..|..||.....|: ...|..:..|.|...|:...|.||::|:|.|.||||||.::...
Mouse    64 VLWDINKNGIEETAAKCRKL-GAQAHPFVVDCSQREEIYSAAKKVKEEVGDVSILVNNAGVVYTA 127

  Fly   185 STPSLKSDEIDTILQLNLGSYIMTTKEFLPKMINRKSGHLVAVNALAGLVPLPGAGIYTATKYGI 249
            ...:.:..:|:...::|:.::..|||.|||.|:....||:|.|.:.||...:|....|.::|:..
Mouse   128 DLFATQDPQIEKTFEVNVLAHFWTTKAFLPVMMKNNHGHIVTVASAAGHTVVPFLLAYCSSKFAA 192

  Fly   250 EGFMESLRAELRLSDCDYVRTTVANAYLMRTSGDLPLLSDAGIAKS-----YPGLPTPYVAEKIV 309
            .||..:|..||....    ||.|      |||...|...:.|..|:     .|.|....|.|.::
Mouse   193 VGFHRALTDELAALG----RTGV------RTSCLCPNFINTGFIKNPSTNLGPTLEPEEVVEHLM 247

  Fly   310 KGVLLNERMVYVPKIFALSVWLLRLLPTKW 339
            .|:|..::|::||...||...|.|::|.::
Mouse   248 HGILTEKQMIFVPSSIALLTVLERIVPERF 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17121NP_651114.1 DltE 91..349 CDD:223377 80/254 (31%)
NADB_Rossmann 94..338 CDD:304358 79/248 (32%)
Hsd17b11NP_444492.1 adh_short 37..228 CDD:278532 64/201 (32%)
17beta-HSDXI-like_SDR_c 38..277 CDD:187598 79/249 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.