DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13837 and CG17147

DIOPT Version :10

Sequence 1:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001262099.1 Gene:CG17147 / 40216 FlyBaseID:FBgn0260393 Length:337 Species:Drosophila melanogaster


Alignment Length:126 Identity:29/126 - (23%)
Similarity:50/126 - (39%) Gaps:29/126 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 KSPSMVKKPAQKAEPLAITLRLLPNAGPCYPYMVCYEGAGLAKACTPAHLVSCNRMQTRENIINC 154
            |:.:.|:||                 |.|..|:.||:|.|....|......:.::....:.:.|.
  Fly    36 KNGTKVRKP-----------------GTCDQYIQCYDGNGTVLTCPSNQSFNPSKGSCVDTLANS 83

  Fly   155 Q-------EGVYG-FMPHPRNCAYFYYCSSGSKLVHRCHLNYTWHYERR--SCVQQSERMC 205
            .       ||:.| ::..|..|..::||.:|..|...|.:..  |::.|  ||:...:.||
  Fly    84 NKYCGNRCEGLDGEWVADPTECHKYFYCMNGVPLAGMCPVGQ--HFDERSQSCLYGVDSMC 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13837NP_651113.1 CBM_14 36..81 CDD:426342
CBM_14 154..203 CDD:426342 14/58 (24%)
CG17147NP_001262099.1 ChtBD2 <44..77 CDD:214696 9/49 (18%)
ChtBD2 89..136 CDD:214696 14/48 (29%)
CBM_14 278..332 CDD:426342
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.