DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13837 and obst-F

DIOPT Version :9

Sequence 1:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_649186.1 Gene:obst-F / 40209 FlyBaseID:FBgn0036947 Length:326 Species:Drosophila melanogaster


Alignment Length:184 Identity:45/184 - (24%)
Similarity:74/184 - (40%) Gaps:34/184 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QLGVYVASSSNCSKYIYCAGPGSFEAECLDGHYYDEKLERCLDRKLVSRCRDPVGITTKSPSMVK 96
            |.|..|....:|:.|..|:...:. ..|..|..:||....| |....:.||.....|.:|.:.:.
  Fly    47 QEGDLVPHPLDCNGYFSCSRVPTL-LYCDQGLQFDENRAIC-DLPENTNCRPVATGTVESANGLA 109

  Fly    97 KPAQ------KAEPLAITLRLLPNAGPCYPYMVCYEGAGLAKACTPAHLVSCNRMQTRENIINCQ 155
            ..::      |.:|:.:.:. :.:..|..| |..|:         |.|             |.|:
  Fly   110 DNSELNWWPHKPKPVFVAVD-VTSGQPVNP-MEKYD---------PEH-------------IECR 150

  Fly   156 E-GVYGFMPHPRNCAYFYYCSSGSKLVHRCHLNYTWHYERRSCVQQSERMCYSE 208
            . |.| |:||||||..::.|:.|....|:|.....|::|:..|....:.:||.|
  Fly   151 HYGAY-FLPHPRNCGLYFICAYGHLHRHQCGRGTAWNFEKSECQLSDQAICYGE 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13837NP_651113.1 CBM_14 36..81 CDD:279884 10/44 (23%)
CBM_14 154..203 CDD:279884 17/49 (35%)
obst-FNP_649186.1 CBM_14 43..94 CDD:279884 12/48 (25%)
CBM_14 156..198 CDD:279884 14/41 (34%)
CBM_14 272..321 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.