DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13837 and obst-H

DIOPT Version :9

Sequence 1:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001034020.1 Gene:obst-H / 39681 FlyBaseID:FBgn0053983 Length:269 Species:Drosophila melanogaster


Alignment Length:254 Identity:70/254 - (27%)
Similarity:92/254 - (36%) Gaps:53/254 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IILVTLLGHRSSALEFEECASAPQLGVYVASSSNCSKYIYCAGPGSFEAECLDGHYYDEKLERC- 72
            :.||.|...|.:|..|:||..... |.:|.|..:|..|:||.|..|.:.:|.||.|:|.:...| 
  Fly     8 LCLVLLWSSRINADHFDECDGMDD-GAFVQSWESCQSYVYCEGEESLKGDCEDGEYFDSEAGTCD 71

  Fly    73 --------LDRKLVSRCRDPVGITTKSPSMVKKPAQKAEPLAI-------TLRLLPNAGP----- 117
                    ||.  |....||...|.:....:....:..||..:       .:.:.|...|     
  Fly    72 IAANVSCFLDE--VDEPSDPEPETDEEEEEIPATPRPTEPPIVETPTEVDIINIAPVVRPNCPIS 134

  Fly   118 --------------CYPYMVCYEG-------------AGLAKACTPAHLVSCNRMQTRENIINCQ 155
                          |..|.:||.|             ..|...|.....|.|.....|.:  .|.
  Fly   135 DDPGQVIFMASNNSCTNYYLCYHGHAMEMHCDNELYFNSLTGQCDYPDKVQCAFEDPRSH--KCL 197

  Fly   156 EGVYGFMPHPRNCAYFYYCSSGSKLVHRCHLNYTWHYERRSCVQQSERMCYSEQLRLIR 214
            ..:..|.|||.||.|||||..|...:.:|...|.|..|||||||.....||....|:.|
  Fly   198 PHMTEFFPHPDNCNYFYYCIKGFLTLQQCPFYYGWDIERRSCVQIGVAKCYGNSRRIGR 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13837NP_651113.1 CBM_14 36..81 CDD:279884 17/53 (32%)
CBM_14 154..203 CDD:279884 23/48 (48%)
obst-HNP_001034020.1 CBM_14 26..77 CDD:279884 16/51 (31%)
CBM_14 142..184 CDD:279884 7/41 (17%)
ChtBD2 203..240 CDD:214696 19/36 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470255
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007617
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.