DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13837 and CG10140

DIOPT Version :10

Sequence 1:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_648648.2 Gene:CG10140 / 39511 FlyBaseID:FBgn0036363 Length:297 Species:Drosophila melanogaster


Alignment Length:171 Identity:37/171 - (21%)
Similarity:56/171 - (32%) Gaps:48/171 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 CSKYIYCAGPGSFEAECLDGHYYDEKLERCLDRKLVSRCRDPVGITTKSPSMVKKPAQKAEPLAI 107
            |::|:.|........:|.||..|:...:||...:.|........|.:.               |.
  Fly   125 CTRYVLCYYGKPVLRQCQDGLQYNSATDRCDFPQNVDCVESECSIYSN---------------AY 174

  Fly   108 TLRLLPNAGPCYPYMVCYEGAGLAKACTPA-HL---VSCNRMQTRENIINCQ------------- 155
            .||.:|:...|..|.:|..|....:.||.. |.   ..|..:.::.   :||             
  Fly   175 HLRYVPSKVSCQKYFICGNGIPREQTCTAGLHFSTKCDCCDIPSKS---DCQIPAVERKVQQLSR 236

  Fly   156 ------------EGVYGFMPHPRNCAYFYYCSSGSKLVHRC 184
                        .||:.::...|..|| |||..|..||..|
  Fly   237 LSPVTTVGICPPSGVHFYVHESRRDAY-YYCVDGHGLVLDC 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13837NP_651113.1 CBM_14 36..81 CDD:426342 10/37 (27%)
CBM_14 154..203 CDD:426342 14/56 (25%)
CG10140NP_648648.2 CBM_14 63..106 CDD:426342
CBM_14 111..161 CDD:426342 9/35 (26%)
CBM_14 178..222 CDD:426342 9/46 (20%)
ChtBD2 244..292 CDD:214696 12/34 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.