| Sequence 1: | NP_651113.1 | Gene: | CG13837 / 42720 | FlyBaseID: | FBgn0039042 | Length: | 223 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_648527.1 | Gene: | CG7252 / 39353 | FlyBaseID: | FBgn0036226 | Length: | 474 | Species: | Drosophila melanogaster |
| Alignment Length: | 39 | Identity: | 18/39 - (46%) |
|---|---|---|---|
| Similarity: | 24/39 - (61%) | Gaps: | 0/39 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 34 GVYVASSSNCSKYIYCAGPGSFEAECLDGHYYDEKLERC 72 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG13837 | NP_651113.1 | CBM_14 | 36..81 | CDD:426342 | 17/37 (46%) |
| CBM_14 | 154..203 | CDD:426342 | |||
| CG7252 | NP_648527.1 | CBM_14 | 30..79 | CDD:426342 | |
| CBM_14 | 175..226 | CDD:426342 | |||
| CBM_14 | 251..296 | CDD:426342 | |||
| CBM_14 | 343..394 | CDD:426342 | |||
| CBM_14 | 420..471 | CDD:426342 | 18/39 (46%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||