DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13837 and CG5897

DIOPT Version :9

Sequence 1:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001356901.1 Gene:CG5897 / 39346 FlyBaseID:FBgn0036220 Length:343 Species:Drosophila melanogaster


Alignment Length:153 Identity:40/153 - (26%)
Similarity:56/153 - (36%) Gaps:41/153 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 EECASAPQLGVYVASSSNCSKYIYCAG-PGSFEAECLDGHYYDEKLERCLDRKLVSRC-RDPVGI 87
            |.|||..... |||:.::|.:::.||. ......:|..|..:..|.:.||:.  |:.| :|.:..
  Fly    88 EICASLEPWN-YVANPADCRRFVKCADLDDPTWGDCGVGQVFSNKKQTCLEE--VAGCPQDNICS 149

  Fly    88 TTKSPSMVKKPAQKAEPLAITLRLLPNAGPCYPYMVCYEGAGLAKACTPAHLVSCNRMQTRENII 152
            ..|..|.|..|..                 |..|..|:.|.|....|      |..|...|:. .
  Fly   150 HMKDGSFVGDPKS-----------------CQIYYKCHNGFGTMLNC------SVGRYFNRKT-G 190

  Fly   153 NCQEGVYGFMPHPRNCAYFYYCS 175
            |||    .:|||        |||
  Fly   191 NCQ----SWMPH--------YCS 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13837NP_651113.1 CBM_14 36..81 CDD:279884 12/45 (27%)
CBM_14 154..203 CDD:279884 8/22 (36%)
CG5897NP_001356901.1 ChtBD2 146..192 CDD:214696 13/69 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.