DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13837 and CG33985

DIOPT Version :9

Sequence 1:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001034018.1 Gene:CG33985 / 3885639 FlyBaseID:FBgn0053985 Length:277 Species:Drosophila melanogaster


Alignment Length:271 Identity:79/271 - (29%)
Similarity:111/271 - (40%) Gaps:68/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GAVTFLTIILVTLLGHRSSALEFEECASAPQLGVYVASSSNCSKYIYCAGPGSFEAECLDGHYYD 66
            |.:.|.:|::..|....|.|..|:||.....|. :|.|..:|:.||:|.|..|::.||.||.|:.
  Fly     3 GVLKFGSILVSLLFLATSHADVFDECNDGNNLS-FVTSPKSCAHYIFCNGDESYDGECEDGEYFS 66

  Fly    67 EKLERC-----LDRKLVSRCR-------------------DPVGITTKSPSMV--KKPA------ 99
            :.:|.|     :|.:..|..:                   ..|.|||.:||.|  .:|:      
  Fly    67 QDMEMCEPMGDIDCRTGSEVQRENTTDSSSTEITSESSTISTVVITTLAPSAVVTLRPSVNQSGA 131

  Fly   100 ------QKAEPLAIT-----------LRLLPNAGPCYPYMVCYEGAGLAKAC-TPAHL------- 139
                  ..|..:.:|           :.||||...|..|.:||.|..|..:| |..|.       
  Fly   132 SSTTSVSPAIEIIVTNVCPQLDNQSRIALLPNQNSCSDYYICYRGVALPMSCATSLHFNSLTGKC 196

  Fly   140 -----VSCNRM--QTRENIINCQEGVYGFMPHPRNCAYFYYCSSGSKLVHRCHLNYTWHYERRSC 197
                 |.|..|  ..||   .|:..|....||..||.|||.|.||..:|.:|...|.|.||:|||
  Fly   197 DHPENVRCLAMTYNPRE---QCKRHVIDVYPHSDNCNYFYQCRSGYLMVQQCPFFYGWDYEKRSC 258

  Fly   198 VQQSERMCYSE 208
            |...:..||::
  Fly   259 VALGQAKCYNK 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13837NP_651113.1 CBM_14 36..81 CDD:279884 17/49 (35%)
CBM_14 154..203 CDD:279884 22/48 (46%)
CG33985NP_001034018.1 CBM_14 28..74 CDD:279884 17/46 (37%)
CBM_14 160..202 CDD:279884 13/41 (32%)
ChtBD2 215..259 CDD:214696 20/43 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470253
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007617
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.