Sequence 1: | NP_651113.1 | Gene: | CG13837 / 42720 | FlyBaseID: | FBgn0039042 | Length: | 223 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001034018.1 | Gene: | CG33985 / 3885639 | FlyBaseID: | FBgn0053985 | Length: | 277 | Species: | Drosophila melanogaster |
Alignment Length: | 271 | Identity: | 79/271 - (29%) |
---|---|---|---|
Similarity: | 111/271 - (40%) | Gaps: | 68/271 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 GAVTFLTIILVTLLGHRSSALEFEECASAPQLGVYVASSSNCSKYIYCAGPGSFEAECLDGHYYD 66
Fly 67 EKLERC-----LDRKLVSRCR-------------------DPVGITTKSPSMV--KKPA------ 99
Fly 100 ------QKAEPLAIT-----------LRLLPNAGPCYPYMVCYEGAGLAKAC-TPAHL------- 139
Fly 140 -----VSCNRM--QTRENIINCQEGVYGFMPHPRNCAYFYYCSSGSKLVHRCHLNYTWHYERRSC 197
Fly 198 VQQSERMCYSE 208 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13837 | NP_651113.1 | CBM_14 | 36..81 | CDD:279884 | 17/49 (35%) |
CBM_14 | 154..203 | CDD:279884 | 22/48 (46%) | ||
CG33985 | NP_001034018.1 | CBM_14 | 28..74 | CDD:279884 | 17/46 (37%) |
CBM_14 | 160..202 | CDD:279884 | 13/41 (32%) | ||
ChtBD2 | 215..259 | CDD:214696 | 20/43 (47%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45470253 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0007617 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.840 |