DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13837 and CG33986

DIOPT Version :9

Sequence 1:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001034017.2 Gene:CG33986 / 3885638 FlyBaseID:FBgn0053986 Length:277 Species:Drosophila melanogaster


Alignment Length:228 Identity:43/228 - (18%)
Similarity:76/228 - (33%) Gaps:62/228 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LGVYVASSSNCSKYIYCAGPG-SFEAECLDGHYYDEKLERCLDRKLVSRCR-------------- 82
            :|.:|..:.:|..:..|...| :..|.|.....::.:...| |.....:||              
  Fly    46 VGEFVEHAEDCHMFYLCVENGDAVLASCPPTMLFNSESRLC-DSATNVKCRNETDPIETPPFDGG 109

  Fly    83 ----DPVGITTKSP---SMVKKPAQKAEPLAITLRLLPNAGPCYPYMVCYEGAGLAKACTP---- 136
                ||..:.|.:.   |.:.:..|.::.:.    .:.::..|..|.:||.|..:.:.|:.    
  Fly   110 NGDGDPNNMVTDAATYCSTLVEQQQSSDRIV----YVGSSSSCRKYYICYYGQAILQECSSQLHW 170

  Fly   137 -AHLVSCN-------------RMQTREN-------------IINCQEGVYG--FMPHPRNCAYFY 172
             |....|:             .|.|..|             :|:|.  .||  ..||.:.|.:|.
  Fly   171 NAMTGKCDIPERAQCTVGGQEDMPTNGNSGFPSGGTAISSDLIHCP--AYGQHLYPHMQRCEFFI 233

  Fly   173 YCSSGSKLVHRCHLNYTWHYERRSCVQQSERMC 205
            ||..|...:.:|...|.:....:||.......|
  Fly   234 YCVKGHASLQQCPFYYFFDIATKSCQWSRTAQC 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13837NP_651113.1 CBM_14 36..81 CDD:279884 8/45 (18%)
CBM_14 154..203 CDD:279884 14/50 (28%)
CG33986NP_001034017.2 CBM_14 41..92 CDD:279884 9/46 (20%)
CBM_14 141..185 CDD:279884 8/43 (19%)
ChtBD2 213..261 CDD:214696 15/49 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470254
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007617
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.