DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13837 and CG4835

DIOPT Version :9

Sequence 1:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_647965.3 Gene:CG4835 / 38619 FlyBaseID:FBgn0035607 Length:1224 Species:Drosophila melanogaster


Alignment Length:234 Identity:53/234 - (22%)
Similarity:82/234 - (35%) Gaps:48/234 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 RSSALEFEECAS--APQLGV--------YVASSSNCSKYIYCAGPGSFEAECLDGHYYDEKLERC 72
            :|:|...|...:  ||:.|:        .:|..:||:|||.|..|......|.||.::..|||:|
  Fly   565 KSTATTTERTTTTVAPKTGICGGRNENENIAYPNNCTKYIVCVSPIPIAFFCPDGTFFSSKLEKC 629

  Fly    73 LDRKLVSRCRDPVGITTKSPSMVKKPAQKAEPLAITLRLLPNAGPC---------YPYM--VC-- 124
            :|....|.|......||..|...:.|.:.......:....|....|         |.||  ||  
  Fly   630 IDDWDESDCEGDQSTTTLEPGYTRPPPEPTMCTNSSRDTFPYPDNCQWFIRCVDDYIYMMDVCNC 694

  Fly   125 ---YE------GAGL-AKAC------------TPAHLVSCNRMQTRENIINCQEGVYG-FMPHPR 166
               |:      ||.: :.||            .|....:..|...::.  .|.:...| .:.:|.
  Fly   695 GEYYDPITEKCGADVPSDACRWDYTSTTSTTSEPTTTTAVTRPPPQKG--PCDDVEDGALVAYPN 757

  Fly   167 NCAYFYYCSSGSKLVHRCHLNYTWHYERRSCVQQSERMC 205
            :|:.:..|.....:...|.....:..|...||..|...|
  Fly   758 DCSKYIQCDRPIAVAFECEKGDEFSVELGKCVDASLANC 796

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13837NP_651113.1 CBM_14 36..81 CDD:279884 17/44 (39%)
CBM_14 154..203 CDD:279884 10/49 (20%)
CG4835NP_647965.3 CBM_14 51..103 CDD:279884
CBM_14 185..237 CDD:279884
CBM_14 273..322 CDD:279884
CBM_14 393..444 CDD:279884
CBM_14 485..539 CDD:279884
CBM_14 585..638 CDD:279884 17/52 (33%)
CBM_14 661..714 CDD:279884 10/52 (19%)
CBM_14 744..796 CDD:279884 10/51 (20%)
CBM_14 914..962 CDD:279884
CBM_14 1175..1212 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.