DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13837 and obst-B

DIOPT Version :9

Sequence 1:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_609339.1 Gene:obst-B / 34336 FlyBaseID:FBgn0027600 Length:337 Species:Drosophila melanogaster


Alignment Length:211 Identity:48/211 - (22%)
Similarity:71/211 - (33%) Gaps:56/211 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EFEECASAPQLGVYVASSSNCSKYIYCAGPGSFEAECLDGHYYDE--KLERCLDRKLVSRCRDPV 85
            |:|.....|:...:...|..|.||..|......|..|.||..:::  .:|...|......|....
  Fly    79 EYEPTEECPEPNGFYPDSKQCDKYYACLDGVPTERLCADGMVFNDYSPIEEKCDLPYNIDCMKRS 143

  Fly    86 GITTKSPSM----------VKKPAQKAEPLAITLRLLPNAGPCYPYMVCYEGAGLAKACTPAHLV 140
            .:.|..||:          .:||                 |.|..:..|.:|......| ||.||
  Fly   144 KLQTPQPSLHCPRKNGYFGHEKP-----------------GICDKFYFCVDGQFNMITC-PAGLV 190

  Fly   141 ------SCNRMQTRENIINCQ-EGVYGF----------MPHPR-----NCAYFYYCSSGSKLVHR 183
                  .|. ...:..:..|: |.|:.|          :.|||     :|.:||.|.:|. |..|
  Fly   191 FNPKTGICG-WPDQVGVTGCKSEDVFDFECPKVNESIAVTHPRYADPNDCQFFYVCVNGD-LPRR 253

  Fly   184 --CHLNYTWHYERRSC 197
              |.|...:..|:.:|
  Fly   254 NGCKLGQVFDEEKETC 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13837NP_651113.1 CBM_14 36..81 CDD:279884 11/46 (24%)
CBM_14 154..203 CDD:279884 18/62 (29%)
obst-BNP_609339.1 CBM_14 89..139 CDD:279884 11/49 (22%)
CBM_14 156..204 CDD:279884 12/66 (18%)
CBM_14 233..278 CDD:279884 11/38 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.