Sequence 1: | NP_651113.1 | Gene: | CG13837 / 42720 | FlyBaseID: | FBgn0039042 | Length: | 223 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_609339.1 | Gene: | obst-B / 34336 | FlyBaseID: | FBgn0027600 | Length: | 337 | Species: | Drosophila melanogaster |
Alignment Length: | 211 | Identity: | 48/211 - (22%) |
---|---|---|---|
Similarity: | 71/211 - (33%) | Gaps: | 56/211 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 EFEECASAPQLGVYVASSSNCSKYIYCAGPGSFEAECLDGHYYDE--KLERCLDRKLVSRCRDPV 85
Fly 86 GITTKSPSM----------VKKPAQKAEPLAITLRLLPNAGPCYPYMVCYEGAGLAKACTPAHLV 140
Fly 141 ------SCNRMQTRENIINCQ-EGVYGF----------MPHPR-----NCAYFYYCSSGSKLVHR 183
Fly 184 --CHLNYTWHYERRSC 197 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13837 | NP_651113.1 | CBM_14 | 36..81 | CDD:279884 | 11/46 (24%) |
CBM_14 | 154..203 | CDD:279884 | 18/62 (29%) | ||
obst-B | NP_609339.1 | CBM_14 | 89..139 | CDD:279884 | 11/49 (22%) |
CBM_14 | 156..204 | CDD:279884 | 12/66 (18%) | ||
CBM_14 | 233..278 | CDD:279884 | 11/38 (29%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |