DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13837 and LOC3291167

DIOPT Version :10

Sequence 1:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_554263.2 Gene:LOC3291167 / 3291167 VectorBaseID:AGAMI1_011587 Length:132 Species:Anopheles gambiae


Alignment Length:129 Identity:30/129 - (23%)
Similarity:53/129 - (41%) Gaps:24/129 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LTIILVTLLGHRSSALEFEECASAPQLGVYV-ASSSNCSKYIYCAGPGSFEAECLDGHYYDEKLE 70
            ::.:.:.||....||:..|  .:....|.|: |:..:|..|.||....::...|..|..:||..:
Mosquito     6 VSTVWIALLALGVSAITAE--PTCRPTGQYLTANPRDCRSYFYCYDGIAYYGVCQQGFRFDESRQ 68

  Fly    71 RCLDRKLVSRCRDPVGITTKSPSMVKKPAQKAEPLAITLRLLPNAGPCYPYMVCYEGAGLAKAC 134
            .||                  ||.|   |:..|...:.:..||:...|..:::|:||....::|
Mosquito    69 SCL------------------PSTV---AECFECPTMGMVSLPHPTSCQKFVLCFEGVANERSC 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13837NP_651113.1 CBM_14 36..81 CDD:426342 12/45 (27%)
CBM_14 154..203 CDD:426342
LOC3291167XP_554263.2 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.