DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13837 and CG31077

DIOPT Version :9

Sequence 1:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_733185.2 Gene:CG31077 / 318583 FlyBaseID:FBgn0051077 Length:988 Species:Drosophila melanogaster


Alignment Length:226 Identity:53/226 - (23%)
Similarity:82/226 - (36%) Gaps:36/226 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TFLTIILVTLLGHRSSALEFEECASAPQL---GVYVASSSNCSKYIYCAGPGSFEAECLDGHYYD 66
            |.|::...||.|..:..:....|.....|   |:...:..:|:.||.|.|..:.|.:|..|.|::
  Fly   616 TDLSLQFTTLDGVDNLDINTGTCVYNNTLFIEGIREVNPQDCAGYIECFGGVAKELKCDSGRYFN 680

  Fly    67 EKLERC----------LDRKLVSRCRDPVGITTKSPSMVKKPAQKAEPLAI----TLRLLPNAGP 117
            |....|          .|:.:|   .|....|..:|:.    ....:|.|.    .|||.|.  .
  Fly   681 ETQRNCSVDVDEICLKSDKTIV---LDLQTTTESTPNF----TTSVDPFAKCRDGQLRLDPK--N 736

  Fly   118 CYPYMVCYEGAGLAKAC--------TPAHLVSCNRMQTRENIINCQEGVYGFMPHPRNCAYFYYC 174
            |..::.|.:|....:.|        |.:..:...|.....||..|.|||.  ...|.|||.:..|
  Fly   737 CAGFLKCVDGELKEEMCPSGFFYNSTSSKCMVDIRATCVTNIKYCIEGVR--EEDPNNCAGYRQC 799

  Fly   175 SSGSKLVHRCHLNYTWHYERRSCVQQSERMC 205
            ..|......|.|...::...|.|:....::|
  Fly   800 IRGLVQNLNCPLGQYFNVAERDCLMDVHKVC 830

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13837NP_651113.1 CBM_14 36..81 CDD:279884 13/54 (24%)
CBM_14 154..203 CDD:279884 14/48 (29%)
CG31077NP_733185.2 CBM_14 43..81 CDD:279884
ChtBD2 <212..245 CDD:214696
CBM_14 267..308 CDD:279884
CBM_14 439..472 CDD:279884
CBM_14 733..769 CDD:279884 6/37 (16%)
CBM_14 881..914 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.