DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13837 and CG33263

DIOPT Version :9

Sequence 1:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_996072.1 Gene:CG33263 / 2768952 FlyBaseID:FBgn0053263 Length:227 Species:Drosophila melanogaster


Alignment Length:249 Identity:62/249 - (24%)
Similarity:88/249 - (35%) Gaps:86/249 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LVTLLGHRSS--ALEFEECASAPQLGVYVASSSNCSKYIYCAGPGSFEAECLDGHYYDEKLERCL 73
            |:.|.|:.:|  |..|.:||:|| |..:|.:..:|:.||||.|..||...|.:..|:|::.:.|.
  Fly    10 LLILAGYLTSIEAEVFPQCANAP-LDTFVMAIEDCASYIYCNGEDSFRDSCPESTYFDDRTQECA 73

  Fly    74 --DRKLVSRCRDPV----------------GI--------------------------------T 88
              |..:..|..|.|                ||                                |
  Fly    74 FDDEGVCLRNSDSVQTEEQPDKQTTGEEQSGIEETTPVPTPPSDYASTGSADSSTFQADSTTTPT 138

  Fly    89 TKSPSMVKKPAQKAEPLAITLRLLPNAGPCYPYMVCYEGAGLAKACTPAHLVSCNRMQTRENIIN 153
            ...||:.:.|...|.|.:      |:|.|..|                        .|.|.   :
  Fly   139 ESIPSVTEPPTTSATPSS------PSAKPSSP------------------------AQERP---H 170

  Fly   154 CQEGVYGFMPHPRNCAYFYYCSSGSKLVHRCHLNYTWHYERRSCVQQSERMCYS 207
            |.....|..|||:.|.|:|.|.||...:.||...|.|.:..:.|...||..|:|
  Fly   171 CDISGDGDHPHPQRCEYYYRCLSGYLTIVRCPYKYGWDFPTKQCKPSSEAQCFS 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13837NP_651113.1 CBM_14 36..81 CDD:279884 14/46 (30%)
CBM_14 154..203 CDD:279884 17/48 (35%)
CG33263NP_996072.1 CBM_14 28..79 CDD:279884 19/51 (37%)
CBM_14 171..222 CDD:279884 18/50 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007617
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.