DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13837 and cht-1

DIOPT Version :10

Sequence 1:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_508588.1 Gene:cht-1 / 180628 WormBaseID:WBGene00000503 Length:617 Species:Caenorhabditis elegans


Alignment Length:170 Identity:35/170 - (20%)
Similarity:54/170 - (31%) Gaps:42/170 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YVASSSNCSKYIYCAGPGSFEAECLDGHYYDEKLERCLDRKLVSRCRDPVGITTKSPSMVKKPAQ 100
            :..:|:||..::.|....|:...|..|..|...|:.| .....|.|.   ..||::|:...|.| 
 Worm   488 FYPNSNNCGLFVLCLSSKSYSMSCPSGLQYSASLKYC-TTSTASGCS---VTTTRAPTTTTKSA- 547

  Fly   101 KAEPLAITLRLLPNAGPCYPYMVCYEGAGLAKACTPAHLVSCNRMQTRENIINCQEGVYGFMPHP 165
               |...|....|.                  ..|||  ..|.:           :|.:|.   |
 Worm   548 ---PTVTTTTRAPT------------------TTTPA--FKCTK-----------DGFFGV---P 575

  Fly   166 RNCAYFYYCSSGSKLVHRCHLNYTWHYERRSCVQQSERMC 205
            .:|..|..|.:|......|....::|.:...|.:.....|
 Worm   576 SDCLKFIRCVNGISYNFECPNGLSFHADTMMCDRPDPSKC 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13837NP_651113.1 CBM_14 36..81 CDD:426342 11/44 (25%)
CBM_14 154..203 CDD:426342 10/48 (21%)
cht-1NP_508588.1 GH18_chitolectin_chitotriosidase 55..423 CDD:119351
CBM_14 481..532 CDD:426342 11/44 (25%)
CBM_14 567..615 CDD:426342 10/61 (16%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.