DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13837 and R02F2.4

DIOPT Version :9

Sequence 1:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_498171.1 Gene:R02F2.4 / 175755 WormBaseID:WBGene00019833 Length:431 Species:Caenorhabditis elegans


Alignment Length:209 Identity:49/209 - (23%)
Similarity:72/209 - (34%) Gaps:63/209 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 SSALEFEE--CASAPQLGVYVASSSNC-SKYIYCAGPGSFEAECLDGHYYDEKLERCLDRKLVSR 80
            ||..|..|  |.|... |||  ||..| |.||.|.........|.....||...::|..:.::..
 Worm   109 SSGDELLENVCESLKD-GVY--SSGTCSSSYIICNSGSPRFLSCSTPLIYDPTNKKCSWKGMIDE 170

  Fly    81 CRDPVGITTKSPSMVKKPAQKAEPLAITLRLLPNAGPC-YPYMVCYEGAGLAKACTPAHLV---- 140
            |....|...:|...:.|                  ..| ..:..|.||....:.| ||:||    
 Worm   171 CSQVSGEYCESDGNISK------------------SECSNVFFSCSEGIAHRRNC-PANLVFNPA 216

  Fly   141 --SCNRMQTRENIINCQEGVYGFMPHPRNC----AYFYY---------CSSGSKLVHRC------ 184
              ||:   ..:|:::|.|.    ...|:||    .||.:         |::|..:|..|      
 Worm   217 ISSCD---WPKNVMDCSEK----SEKPQNCGEVDGYFSFGRCSSSFSACTNGIPIVMFCPDGLMF 274

  Fly   185 -----HLNYTWHYE 193
                 ..:|.|:.:
 Worm   275 SEKNQMCDYEWNVD 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13837NP_651113.1 CBM_14 36..81 CDD:279884 12/45 (27%)
CBM_14 154..203 CDD:279884 13/64 (20%)
R02F2.4NP_498171.1 CBM_14 25..74 CDD:279884
ChtBD2 117..165 CDD:214696 16/50 (32%)
CBM_14 185..229 CDD:279884 13/65 (20%)
ChtBD2 240..283 CDD:214696 6/42 (14%)
CBM_14 310..361 CDD:279884
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.