Sequence 1: | NP_651113.1 | Gene: | CG13837 / 42720 | FlyBaseID: | FBgn0039042 | Length: | 223 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_498171.1 | Gene: | R02F2.4 / 175755 | WormBaseID: | WBGene00019833 | Length: | 431 | Species: | Caenorhabditis elegans |
Alignment Length: | 209 | Identity: | 49/209 - (23%) |
---|---|---|---|
Similarity: | 72/209 - (34%) | Gaps: | 63/209 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 19 SSALEFEE--CASAPQLGVYVASSSNC-SKYIYCAGPGSFEAECLDGHYYDEKLERCLDRKLVSR 80
Fly 81 CRDPVGITTKSPSMVKKPAQKAEPLAITLRLLPNAGPC-YPYMVCYEGAGLAKACTPAHLV---- 140
Fly 141 --SCNRMQTRENIINCQEGVYGFMPHPRNC----AYFYY---------CSSGSKLVHRC------ 184
Fly 185 -----HLNYTWHYE 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13837 | NP_651113.1 | CBM_14 | 36..81 | CDD:279884 | 12/45 (27%) |
CBM_14 | 154..203 | CDD:279884 | 13/64 (20%) | ||
R02F2.4 | NP_498171.1 | CBM_14 | 25..74 | CDD:279884 | |
ChtBD2 | 117..165 | CDD:214696 | 16/50 (32%) | ||
CBM_14 | 185..229 | CDD:279884 | 13/65 (20%) | ||
ChtBD2 | 240..283 | CDD:214696 | 6/42 (14%) | ||
CBM_14 | 310..361 | CDD:279884 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |