DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13837 and cpg-1

DIOPT Version :10

Sequence 1:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster
Sequence 2:NP_001021159.1 Gene:cpg-1 / 175586 WormBaseID:WBGene00000465 Length:584 Species:Caenorhabditis elegans


Alignment Length:69 Identity:18/69 - (26%)
Similarity:29/69 - (42%) Gaps:11/69 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 CYEGAGLAKACTPAHLVSCNRMQTRENIINCQEGVYGFMPHPRNCAYFYYCSSGSKLVHRCHLNY 188
            |.|||...:.|: .|..:|  :..:|.|..|:.|:: |.|....||       .:..:..||...
 Worm   527 CVEGATAIEPCS-QHYKNC--VNGQEAIFICENGLF-FSPEQARCA-------PADQIAECHQTT 580

  Fly   189 TWHY 192
            ..:|
 Worm   581 VQYY 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13837NP_651113.1 CBM_14 36..81 CDD:426342
CBM_14 154..203 CDD:426342 9/39 (23%)
cpg-1NP_001021159.1 CBM_14 61..113 CDD:426342
rne <116..206 CDD:236766
CBM_14 214..266 CDD:426342
rne <321..499 CDD:236766
CBM_14 <539..576 CDD:426342 10/46 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.