DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13837 and LOC1279248

DIOPT Version :10

Sequence 1:NP_651113.1 Gene:CG13837 / 42720 FlyBaseID:FBgn0039042 Length:223 Species:Drosophila melanogaster
Sequence 2:XP_318942.4 Gene:LOC1279248 / 1279248 VectorBaseID:AGAMI1_001027 Length:89 Species:Anopheles gambiae


Alignment Length:44 Identity:14/44 - (31%)
Similarity:19/44 - (43%) Gaps:0/44 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 MPHPRNCAYFYYCSSGSKLVHRCHLNYTWHYERRSCVQQSERMC 205
            :||..:|..||.|.:|.|....|.....|:.|:..|....|..|
Mosquito    38 IPHFTDCTKFYKCFNGKKYEMDCPAGLHWNIEKDFCDFPEEANC 81

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13837NP_651113.1 CBM_14 36..81 CDD:426342
CBM_14 154..203 CDD:426342 12/40 (30%)
LOC1279248XP_318942.4 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.