DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13838 and bbln

DIOPT Version :10

Sequence 1:NP_651112.1 Gene:CG13838 / 42719 FlyBaseID:FBgn0039041 Length:91 Species:Drosophila melanogaster
Sequence 2:XP_002935549.1 Gene:bbln / 100379753 XenbaseID:XB-GENE-986923 Length:82 Species:Xenopus tropicalis


Alignment Length:49 Identity:14/49 - (28%)
Similarity:28/49 - (57%) Gaps:2/49 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 ELTNNSERLMARVNSSLDDLNTALDNLEARTDRVLVEIRRLISSEMPAQ 78
            |.|.:.:  .|.::..||.:|..||:||.:.|::..:::.|:.|...|:
 Frog    14 EATGDED--YAALDFMLDQINFCLDHLEEKNDQLHAQLQELLESNRQAR 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13838NP_651112.1 None
bblnXP_002935549.1 UPF0184 1..66 CDD:112485 14/49 (29%)

Return to query results.
Submit another query.