DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and Rdh10

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_598593.1 Gene:Rdh10 / 98711 MGIID:1924238 Length:341 Species:Mus musculus


Alignment Length:231 Identity:72/231 - (31%)
Similarity:112/231 - (48%) Gaps:28/231 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LIAKLCWCSAP--KSIAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVKQIQDI 99
            ::|...|...|  ||:||:|.::||||.||||..:||.|::...:.:.|||....|:|...::.|
Mouse    19 VLAAARWLVRPKEKSVAGQVCLITGAGSGLGRLFALEFARRRALLVLWDINTQSNEETAGMVRHI 83

  Fly   100 YK------------------------VRAKAYKANVTNYDDLVELNSKVVEEMGPVTVLVNNAGV 140
            |:                        ::...|..:|...:::.....:|.:|:|.|:||||||||
Mouse    84 YRDLEAADAAALQAGKGEEEILPPCNLQVFTYTCDVGKRENVYLTAERVRKEVGEVSVLVNNAGV 148

  Fly   141 MM-HRNMFNPDPADVQLMINVNLTSHFWTKLVFLPKMKELRKGFIVTISSLAGVFPLPYSATYTT 204
            :. |..:..||.. ::..:.||..:||||...|||.|.|:..|.|||::|..|:|.......|..
Mouse   149 VSGHHLLECPDEL-IERTMMVNCHAHFWTTKAFLPTMLEINHGHIVTVASSLGLFSTAGVEDYCA 212

  Fly   205 TKSGALAHMRTLRMELDLENQKDIHVTTVLPSFLRT 240
            :|.|.:....:|..||....:..|..|.|.|..:.|
Mouse   213 SKFGVVGFHESLSHELKAAEKDGIKTTLVCPYLVDT 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 65/213 (31%)
NADB_Rossmann 54..297 CDD:304358 65/212 (31%)
Rdh10NP_598593.1 adh_short 37..252 CDD:278532 65/213 (31%)
17beta-HSDXI-like_SDR_c 38..307 CDD:187598 65/212 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.