DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and YDL114W

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_010169.1 Gene:YDL114W / 851444 SGDID:S000002272 Length:308 Species:Saccharomyces cerevisiae


Alignment Length:230 Identity:56/230 - (24%)
Similarity:109/230 - (47%) Gaps:27/230 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 AVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVKQIQ--DIYKVRAKAYKANVTNYDDL 117
            |::||...|||..::.||:::...:.|.||.   :..|..|::  :|:     .|:.::|:.|::
Yeast    41 ALITGGSSGLGFELAKELSRRINKVIVADIQ---SFPTFAQVEYNNIF-----YYQCDITSLDEI 97

  Fly   118 VELNSKVVEEMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTKLVFLPKMKELRKG 182
            ..|...:..:.|.:.:::|||||...:.:.:....:|:.:|::||...:.....|...|.:.|:|
Yeast    98 KNLKKAIERDHGNINIIINNAGVAHIKKLEHMTNKEVEQLIDINLIGAYRIISTFAEDMIDNREG 162

  Fly   183 FIVTISSLAGVFPLPYSATYTTTKSGALA-------HMRTLRMELDLENQKDIHVTTVLPSFLRT 240
            ||:.|:|:.|........:|..:|...:.       |.|:|..|.   |:..|....|.|..::|
Yeast   163 FIINIASVLGELTPARLTSYGASKGAMIGFHKCMSRHFRSLSTEC---NKTGIKTLLVCPGKIKT 224

  Fly   241 NS--DVTQLTHTIGFGDVYPLFTGEEVAQRIVAGM 273
            |.  ||...:..:. .|:.|    .::|..|::.|
Yeast   225 NMFIDVPTPSKLLA-PDIIP----SQLALAIISAM 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 47/194 (24%)
NADB_Rossmann 54..297 CDD:304358 56/230 (24%)
YDL114WNP_010169.1 17beta-HSDXI-like_SDR_c 40..282 CDD:187598 56/230 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 91 1.000 Domainoid score I1741
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 1 1.000 - - mtm9177
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.870

Return to query results.
Submit another query.