DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and TDA5

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_013530.1 Gene:TDA5 / 851146 SGDID:S000004418 Length:326 Species:Saccharomyces cerevisiae


Alignment Length:336 Identity:77/336 - (22%)
Similarity:130/336 - (38%) Gaps:77/336 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ITPLL---ILVALLGR---------------------LIA--------KLCWCSAPKSIAGEVAV 56
            :.|||   :||||:.|                     |||        ::.|.|. :.....:.:
Yeast    11 VLPLLRYPLLVALVLRWSLSDSISICLTIYTLLINAFLIANSYIKRSGQVAWKSL-REFKNGIVL 74

  Fly    57 VTGAGHGLGRAISLELAKKGCHIAVVDINV-------SGAEDTVKQIQDIYKVRA------KAYK 108
            :||...||||||..:|.:...::.::::::       :..:|.:..:.|..:|.|      :.||
Yeast    75 ITGGSKGLGRAIVSQLLQDYSNLTILNVDICPSSVRNTRVKDLICDLSDDEEVAALLNLLKRKYK 139

  Fly   109 ANVTNYDDLVELNSKVVEEMGPVTVLVNNAGVMMHRNMFN---PDPADVQLMINVNLTSHFWTKL 170
                                ..:.::||||||..:...||   .|..|....||......|..:|
Yeast   140 --------------------NEIRLIVNNAGVRANFTGFNGMERDNLDKIFKINTFAPLQFIQEL 184

  Fly   171 VFLPKMKELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMELDLENQKDIHVTTVLP 235
            .  |.....|:.:||.|:|:.|:......|.|..:|:..:|..::...||..|..::|....|.|
Yeast   185 A--PSRHSTRQCYIVNIASILGILTPAKVAAYAASKAALIAFHQSYSFELQNEGVRNIRTLLVTP 247

  Fly   236 SFLRTNSDVTQLTHTIGFGDVYPLFTGEEVAQRIVAGMVRGE-AEITVPGMACLLYRVILILPAD 299
            ..|.|............|..|..:.|   :|.:||.....|: .::..| ..|....:::.:|..
Yeast   248 GQLNTEMFAGFKPPRQFFAPVIDITT---LAAKIVRYCELGQRGQLNEP-FYCSFAHLLMCVPYS 308

  Fly   300 WQDRIILLFSR 310
            .| ||:..|||
Yeast   309 LQ-RIVRSFSR 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 47/203 (23%)
NADB_Rossmann 54..297 CDD:304358 57/259 (22%)
TDA5NP_013530.1 NADB_Rossmann 72..309 CDD:419666 58/262 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9177
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.