DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and SDR2

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_190736.1 Gene:SDR2 / 824331 AraportID:AT3G51680 Length:303 Species:Arabidopsis thaliana


Alignment Length:221 Identity:60/221 - (27%)
Similarity:102/221 - (46%) Gaps:20/221 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 PKSIAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDI-NVSGAEDTVKQIQDIYKVRAKAY-KA 109
            ||.:.|:||::||..||:|:|..:..|:.|..:.:.|: ||:|: ...|.:.........|: ..
plant    29 PKRLEGKVAIITGGAHGIGKATVMLFARHGATVVIADVDNVAGS-SLAKSLSSHKTSPMVAFISC 92

  Fly   110 NVTNYDDLVELNSKVVEEMGPVTVLVNNAGVM----MHRNM--FNPDPADVQLMIN---VNLTSH 165
            :|:...|:..|.:..|...|.:.:|.|||||:    .|:::  |:.|..|..:.:|   |.|...
plant    93 DVSVEADVENLVNVTVARYGRLDILFNNAGVLGDQKKHKSILDFDADEFDHVMRVNVRGVGLGMK 157

  Fly   166 FWTKLVFLPKMKELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMELDLENQKDIHV 230
            ...:.:    :|...||.|::.:|:|||........||.:|...:...:....||   .:..|.|
plant   158 HGARAM----IKRGFKGCIISTASVAGVMGGMGPHAYTASKHAIVGLTKNAACEL---GKYGIRV 215

  Fly   231 TTVLPSFLRTNSDVTQLTHTIGFGDV 256
            ..:.|..:.|:..|.....|.| |||
plant   216 NCISPFGVATSMLVNAWRKTSG-GDV 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 50/198 (25%)
NADB_Rossmann 54..297 CDD:304358 57/214 (27%)
SDR2NP_190736.1 PLN02253 23..296 CDD:177895 60/221 (27%)
NADB_Rossmann 31..295 CDD:304358 58/219 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.