DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and SDR3

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_182235.1 Gene:SDR3 / 819326 AraportID:AT2G47130 Length:257 Species:Arabidopsis thaliana


Alignment Length:228 Identity:57/228 - (25%)
Similarity:96/228 - (42%) Gaps:21/228 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVKQIQDIYKVRAKAYKANVTNYDD 116
            |::|::||...|:|..........|..:.:||......::....:.   |.:|..|:.:|||..:
plant     8 GKIAIITGGASGIGAEAVRLFTDHGAKVVIVDFQEELGQNVAVSVG---KDKASFYRCDVTNEKE 69

  Fly   117 LVELNSKVVEEMGPVTVLVNNAGVMMHRNMF---NPDPADVQLMINVNLTSHFWTKLVFLPKMKE 178
            :.......||:.|.:.||.:|||||.....|   |.:..|..:.:||...:.| .|......:::
plant    70 VENAVKFTVEKYGKLDVLFSNAGVMEQPGSFLDLNLEQFDRTMAVNVRGAAAF-IKHAARAMVEK 133

  Fly   179 LRKGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMELDLENQKDIHVTTVLPSFLRT--N 241
            ..:|.||..:|:|.....|....||.:|...|..:::....|   .:..|.|..|.|..:.|  |
plant   134 GTRGSIVCTTSVASEIGGPGPHAYTASKHALLGLVKSACGGL---GKYGIRVNGVAPYAVATAIN 195

  Fly   242 SDVTQLTHTIGFGDVYPLFTGEEVAQRIVAGMV 274
            |   :...|:...:.|...||      |:.|:|
plant   196 S---RDEETVRMVEEYSAATG------ILKGVV 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 47/192 (24%)
NADB_Rossmann 54..297 CDD:304358 56/226 (25%)
SDR3NP_182235.1 PLN02253 1..254 CDD:177895 57/228 (25%)
NADB_Rossmann 5..252 CDD:304358 57/228 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.