DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and Hsdl2

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_077217.2 Gene:Hsdl2 / 72479 MGIID:1919729 Length:490 Species:Mus musculus


Alignment Length:173 Identity:52/173 - (30%)
Similarity:81/173 - (46%) Gaps:20/173 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 IAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVKQ---IQDIYKVRAKAYKAN- 110
            :||....:|||..|:|:||:|:.||.|.:|.:      .|:.|.|.   :..||....:...|. 
Mouse     8 LAGCTVFITGASRGIGKAIALKAAKDGANIVI------AAKTTQKHPKLLGTIYTAAEEIEAAGG 66

  Fly   111 -----VTNYDDLVELNS---KVVEEMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFW 167
                 |.:..|..::||   |.||:.|.:.:|||||..:...|..:.....|.||:|||....:.
Mouse    67 TALPCVVDVRDEQQINSAVEKAVEKFGGIDILVNNASAISLTNTLDTPTKRVDLMMNVNTRGTYL 131

  Fly   168 TKLVFLPKMKELRKGFIVTISSLAGVFPLPYS--ATYTTTKSG 208
            |....:|.:|:.:.|.|:.:|....:.||.:.  ..||..|.|
Mouse   132 TSKACIPFLKKSKVGHILNLSPPLNLNPLWFKQHCAYTIAKYG 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 50/170 (29%)
NADB_Rossmann 54..297 CDD:304358 50/169 (30%)
Hsdl2NP_077217.2 HSDL2_SDR_c 8..248 CDD:187663 52/173 (30%)
adh_short 12..197 CDD:278532 50/169 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 282..370
SCP2 390..483 CDD:280250
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1809
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.