DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and rdh10a

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001074052.1 Gene:rdh10a / 562840 ZFINID:ZDB-GENE-070112-2242 Length:339 Species:Danio rerio


Alignment Length:238 Identity:73/238 - (30%)
Similarity:112/238 - (47%) Gaps:35/238 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 LIAKLCWC-----------SAPKSIAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAE 90
            ::.|:||.           ...||:||:|.|:||||.||||..:.|.|::...:.:.|||....|
Zfish    10 VMLKVCWAIVMAGFKWLIRPKEKSVAGQVCVITGAGGGLGRLFAKEFARRRATLVLWDINSHSNE 74

  Fly    91 DTVKQIQDIYK----------------------VRAKAYKANVTNYDDLVELNSKVVEEMGPVTV 133
            :|.:.::.||:                      .:...|..:|...:.:.....||..|:|.|.:
Zfish    75 ETAEMVRQIYREQDNPMSKEGAVGGVEEVPPFQPQVYTYVLDVGKRESVYSTAEKVRREVGEVDL 139

  Fly   134 LVNNAGVMM-HRNMFNPDPADVQLMINVNLTSHFWTKLVFLPKMKELRKGFIVTISSLAGVFPLP 197
            |:|||||:. |..:..||....:.|: ||..:||||...|||||.|:..|.|||::|..|:|...
Zfish   140 LINNAGVVSGHHLLECPDELIERTMV-VNCHAHFWTTKAFLPKMLEMNHGHIVTVASSLGLFSTA 203

  Fly   198 YSATYTTTKSGALAHMRTLRMELDLENQKDIHVTTVLPSFLRT 240
            ....|..:|.||:....:|..|:....:..|.:|.|.|..:.|
Zfish   204 GVEDYCASKFGAIGFHESLSHEIQASEKDGIKMTLVCPYLVDT 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 66/211 (31%)
NADB_Rossmann 54..297 CDD:304358 66/210 (31%)
rdh10aNP_001074052.1 adh_short 37..250 CDD:278532 66/211 (31%)
17beta-HSDXI-like_SDR_c 38..305 CDD:187598 66/210 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.