DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and HSD17B12

DIOPT Version :10

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_057226.1 Gene:HSD17B12 / 51144 HGNCID:18646 Length:312 Species:Homo sapiens


Alignment Length:195 Identity:57/195 - (29%)
Similarity:96/195 - (49%) Gaps:13/195 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVKQIQDIYKVRAKAYKANVTNYD- 115
            ||.|||||:..|:|::.:.||||.|..:.::..:....:....:|::.:||..:....:..:.| 
Human    50 GEWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFASEDI 114

  Fly   116 -DLVELNSKVVEEMGPVTVLVNNAGVMMHRNMFNPDPAD----VQLMINVNLTSHFWTKLVFLPK 175
             |.::.....:|    :.:||||.|:......:..|..|    ::.|||:|:.|......:.||.
Human   115 YDKIKTGLAGLE----IGILVNNVGMSYEYPEYFLDVPDLDNVIKKMININILSVCKMTQLVLPG 175

  Fly   176 MKELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMELDLENQKDIHVTTVLPSFLRT 240
            |.|..||.|:.|||.:|:.|:|....|:.||:......:.|..|.   ..|.:.|.:|||.|:.|
Human   176 MVERSKGAILNISSGSGMLPVPLLTIYSATKTFVDFFSQCLHEEY---RSKGVFVQSVLPYFVAT 237

  Fly   241  240
            Human   238  237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 YqjQ 49..305 CDD:440069 57/195 (29%)
HSD17B12NP_057226.1 17beta-HSD1_like_SDR_c 50..289 CDD:187614 57/195 (29%)
Di-lysine motif 308..312
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.