DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and Sdr16c6

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001102826.1 Gene:Sdr16c6 / 502939 RGDID:1562060 Length:316 Species:Rattus norvegicus


Alignment Length:270 Identity:83/270 - (30%)
Similarity:142/270 - (52%) Gaps:11/270 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LVALLGRLIAKLCWCSAPKSIAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVK 94
            |.:|:.::|.|     ..|.::||:.::||||.||||.:::..|..|..:.:.|||..|..:|.|
  Rat    19 LESLVFKVIPK-----RRKDVSGEIVLITGAGSGLGRLLAMHFANHGATLVLWDINQEGNMETYK 78

  Fly    95 QIQDIYKVRAKAYKANVTNYDDLVELNSKVVEEMGPVTVLVNNAGVMMHRNMFNPDPADVQLMIN 159
            .::....|:..|||.:.:|..::..:..:|.||:|.||:|:||||::..::..:.....|:....
  Rat    79 LVKQKGDVKVFAYKCDCSNRTEVYRVADQVREEVGDVTILINNAGIVTGKSFLDTPDHLVEKSFL 143

  Fly   160 VNLTSHFWTKLVFLPKMKELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMELDLEN 224
            ||..||||....|||.|.....|.:|.|||:|||..:...:.|:::|..|.....:|.:||.:..
  Rat   144 VNAISHFWICKTFLPAMINANHGHLVCISSIAGVVGINGLSDYSSSKFAAFGLAESLFLELTMVR 208

  Fly   225 QKDIHVTTVLPSFLRTNS-DVTQLTHTIGFGDVYPLFTGEEVAQRIVAGMVRGEAEITVPGMACL 288
            :.:|..|.|.|.|::|.. :..:..:.:    :.||...|.|||:|...::..:..:.:|..|..
  Rat   209 KTNIKSTIVCPYFIKTGMFEGCKTKYPL----LLPLLEQEFVAQKIFHAILEDQVYLLIPKFAYF 269

  Fly   289 -LYRVILILP 297
             |:...||.|
  Rat   270 TLFLKQLISP 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 63/187 (34%)
NADB_Rossmann 54..297 CDD:304358 75/244 (31%)
Sdr16c6NP_001102826.1 17beta-HSDXI-like_SDR_c 38..274 CDD:187598 73/239 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.