DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and hsd17b13

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001011240.1 Gene:hsd17b13 / 496682 XenbaseID:XB-GENE-995635 Length:300 Species:Xenopus tropicalis


Alignment Length:267 Identity:80/267 - (29%)
Similarity:138/267 - (51%) Gaps:19/267 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KSIAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVKQIQDIYKVRAKAYK--AN 110
            ||:||.:.::||:|||:||..:||.||....:.:.|||..|.|:|..:.:   |:.|.||.  .:
 Frog    32 KSVAGNIVLITGSGHGIGRRTALEFAKHESILVLWDINQKGVEETADECR---KLGATAYAFVVD 93

  Fly   111 VTNYDDLVELNSKVVEEMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTKLVFLPK 175
            .:..:|:.....||.:::|.|.:|:|||||:............::...:||:.:||||...||..
 Frog    94 CSTRNDIYRCAEKVKQDIGDVDILINNAGVVFGTEFLKLQDHQIEKTFSVNILAHFWTTKSFLSA 158

  Fly   176 MKELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMELDLENQKDIHVTTVLPSFLRT 240
            |.:..:|.|||::|:||...:||...|..:|.|.:....:|..||.|..:..:..|.:.|.|:.|
 Frog   159 MMKKDRGHIVTVASIAGQLGVPYLVDYCASKFGLVGFHESLTSELKLLGKDGVKTTCLCPVFVNT 223

  Fly   241 NSDVTQLTHTIGFGDVYPLFTGEEVAQRIVAGMVRGEAEITVPGMACLLYRVIL--ILPADWQDR 303
            .......|.      |:|:...|:|.:.::.|::..:..|.||  :.:.|.:|:  .||    :|
 Frog   224 GFVQNPSTR------VWPVLKTEDVVKCLMEGILTNKKMIIVP--SSVKYSLIMNQFLP----ER 276

  Fly   304 IILLFSR 310
            :|...::
 Frog   277 VIATMTK 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 60/189 (32%)
NADB_Rossmann 54..297 CDD:304358 72/246 (29%)
hsd17b13NP_001011240.1 17beta-HSDXI-like_SDR_c 38..277 CDD:187598 74/253 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.