DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and dhrs3

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001008431.1 Gene:dhrs3 / 493258 XenbaseID:XB-GENE-955324 Length:302 Species:Xenopus tropicalis


Alignment Length:280 Identity:78/280 - (27%)
Similarity:147/280 - (52%) Gaps:8/280 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IGLAAITPLLILVALLGRLIAKLCWCSAPKSIAGEVAVVTGAGHGLGRAISLELAKKGC-HIAVV 82
            :|...:.|:.:|.|:| :..|.|...:..:.::|:..::||.|.|:||.::.|.||:.. .|.:.
 Frog     6 VGRLLLFPVQMLFAIL-KAAANLLMPTRLRDLSGDTVLITGGGRGIGRHLAREFAKQNAKKIILW 69

  Fly    83 DINVSGAEDTVKQIQDIYKVRAKAYKANVTNYDDLVELNSKVVEEMGPVTVLVNNAGVMMHRNMF 147
            .......::|.::|:.: ......:..:|.|.:::.:....|.|::|.||:|||||.|:..:::.
 Frog    70 GRTERCLKETTEEIKQM-GTDCSYFVCDVGNREEVYQQAKAVREKVGDVTILVNNAAVVHGKSLM 133

  Fly   148 NPDPADVQLMINVNLTSHFWTKLVFLPKMKELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAH 212
            :.|...:....::|....|||...|||:|.||:.|.||.|:|:..:..:|.:..|.|:|:.:.|.
 Frog   134 DSDDDALLKSQHINTLGQFWTTKAFLPRMLELQNGHIVCINSVLALSAIPGAIDYCTSKASSFAF 198

  Fly   213 MRTLRMELDLENQKDIHVTTVLPSFLRTNSDVTQLTHTIGFGDVYPLFTGEEVAQRIVAGMVRGE 277
            |.:|  .|.|.:...::.|||||  ..||:::.| ...:.|.:::|....|.||.:.|..:.:.:
 Frog   199 MESL--TLGLLDCPGVNATTVLP--FHTNTEMFQ-GMRVRFPNLFPPLKPETVATKTVEAVQKNK 258

  Fly   278 AEITVPGMACLLYRVILILP 297
            |.:.:|.....|..:..|||
 Frog   259 AFLLLPWTMHALVILKSILP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 55/188 (29%)
NADB_Rossmann 54..297 CDD:304358 68/243 (28%)
dhrs3NP_001008431.1 17beta-HSDXI-like_SDR_c 53..281 CDD:187598 64/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.