DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and dhrs3a

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001003477.1 Gene:dhrs3a / 445083 ZFINID:ZDB-GENE-040801-217 Length:302 Species:Danio rerio


Alignment Length:293 Identity:74/293 - (25%)
Similarity:140/293 - (47%) Gaps:32/293 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 LIGLAAITPLLILVALLGRLIAKLCWCSAPKSIAGEVAVVTGAGHGLGRAISLELAKKGCHIAVV 82
            ::|.|.:.|..|:.::| :...:.......:.:..:|.::||.|.|:||.::.|.||:|....::
Zfish     5 VLGCALLFPFQIVFSIL-KATVRFFTRQKRRDLGTDVVLITGGGRGIGRHLAKEFAKQGARKVIL 68

  Fly    83 -------------DINVSGAEDTVKQIQDIYKVRAKAYKANVTNYDDLVELNSKVVEEMGPVTVL 134
                         :|:::|.|             ...:..:|.|.:::.:....:.|::|.||:|
Zfish    69 WGRTEKCLKETCEEISMTGTE-------------CHYFVCDVGNREEVYQQAKVLREKVGDVTIL 120

  Fly   135 VNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTKLVFLPKMKELRKGFIVTISSLAGVFPLPYS 199
            ||||.|:..:::...|...:....::|....|||...|||:|.||..|.:|.|:|:..:..:|.:
Zfish   121 VNNAAVVHGKSLMESDDDALLKTQHINTLGQFWTTKAFLPRMLELCNGHVVCINSILSLSSIPGA 185

  Fly   200 ATYTTTKSGALAHMRTLRMELDLENQKDIHVTTVLPSFLRTNSDVTQLTHTIGFGDVYPLFTGEE 264
            ..|.|:|:.:.|.|.:|  .|.|.:...:..|||||  ..|::::.| ...:.|..::|....|.
Zfish   186 IDYCTSKASSYAFMESL--TLGLLDCPGVGCTTVLP--FHTDTEMFQ-GMRVRFPKLFPPLNPEM 245

  Fly   265 VAQRIVAGMVRGEAEITVPGMACLLYRVILILP 297
            ||:|.|..:....|.:.:|.....|..:..:||
Zfish   246 VAERTVDAVRTNTAFVVLPWTMHFLVILKSLLP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 55/200 (28%)
NADB_Rossmann 54..297 CDD:304358 67/255 (26%)
dhrs3aNP_001003477.1 PRK09072 41..291 CDD:236372 68/256 (27%)
17beta-HSDXI-like_SDR_c 53..281 CDD:187598 62/244 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.