DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and sro

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_651725.1 Gene:sro / 43512 FlyBaseID:FBgn0262112 Length:335 Species:Drosophila melanogaster


Alignment Length:212 Identity:52/212 - (24%)
Similarity:92/212 - (43%) Gaps:25/212 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 VAVVTGAGHGLGRAISLELAKKGCHIAVV----DINVSGAEDTVKQIQDIYKVRAKAYKANVTNY 114
            |.::||...|||.:::: ...:..|:.|:    :|...||    |.:|.:...:....:.:....
  Fly    28 VVLITGCDSGLGHSMAV-YCHESLHMTVISCCHNIKSEGA----KLLQGLASAKDGLSRMHTLEL 87

  Fly   115 D----DLVELNSKVVEEM---GP---VTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTK 169
            |    |.:.|..:.:.::   .|   :|.|:||||||............::..||.||.......
  Fly    88 DLLEPDSIRLVHRQLRDILAKDPSYRLTALINNAGVMCFGEFEWQLTEQIEAQINCNLLGTMRLT 152

  Fly   170 LVFLPKMKELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMELDLENQKDIHVTTVL 234
            ...||.::: ::|.|:.::|..|:..||....|..:|:.......:||:||   .|..:.|...:
  Fly   153 HELLPLLRQ-QQGRIINVTSHCGLQALPALGPYAASKAALRFWTDSLRVEL---QQYGMEVVNFI 213

  Fly   235 P-SF-LRTNSDVTQLTH 249
            | || |.:|....|..|
  Fly   214 PGSFVLDSNIAARQQQH 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 49/202 (24%)
NADB_Rossmann 54..297 CDD:304358 52/212 (25%)
sroNP_651725.1 17beta-HSD-like_SDR_c 27..300 CDD:187632 52/212 (25%)
adh_short 28..229 CDD:278532 51/209 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447496
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.