DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and CG8888

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_610724.1 Gene:CG8888 / 36293 FlyBaseID:FBgn0033679 Length:388 Species:Drosophila melanogaster


Alignment Length:235 Identity:43/235 - (18%)
Similarity:83/235 - (35%) Gaps:54/235 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 IIALIGLAAITPLLILV----ALLGRLIAKLCWCSAPKSIAGEVAVVTGAGHGLGRAISLELAKK 75
            ::..:.:::|:...:.|    |.:|   |.|.:.....|.:|:..::||....|...::.:|...
  Fly    57 LLHALDISSISTFAVFVWFALATVG---AVLFYHFVKVSASGKGVLITGCEAPLAWYLAKKLDDL 118

  Fly    76 GCHIAVVDINVSGAE-DTVKQIQDIYKVRAKAYKANVTNYDDLVELNSKVVE------------- 126
            |..: ....|....| |..|.::::...|.|....:||:...::|....|.:             
  Fly   119 GFTV-YAGFNTPIEESDEAKILKEVTSGRMKLLHLDVTSEKTILEAARYVSQHLPHGAEGLWSVV 182

  Fly   127 -----------EMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTKLVFLPKMKELR 180
                       |..|..||..:              .|:.|:.:..||.      :|||.::...
  Fly   183 HCAHWIALGELEWIPFAVLRKS--------------LDLNLLGSARLTQ------IFLPLVRRAH 227

  Fly   181 KGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMEL 220
             |.:|.::|.....|.|.......|::........||.|:
  Fly   228 -GRVVFLTSGLNRVPSPVRGIQCATQAAVDCFAACLRQEM 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 35/193 (18%)
NADB_Rossmann 54..297 CDD:304358 35/192 (18%)
CG8888NP_610724.1 NADB_Rossmann 96..380 CDD:304358 35/193 (18%)
adh_short 96..293 CDD:278532 35/193 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447538
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.