DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and CG2070

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster


Alignment Length:270 Identity:63/270 - (23%)
Similarity:112/270 - (41%) Gaps:52/270 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVKQI------QDIYKVRAKAYKAN 110
            |.||:|||...|:|:...||||::|..:.:...::...|:..::|      |:|:     |.:.:
  Fly    43 GRVAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCENARREIIKATNNQNIF-----ARQLD 102

  Fly   111 VTNYDDLVELNSKVVEEMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTKLVFLPK 175
            :.:...:....:....|...:.:|:||||:|....|...|..::|  |.||...||...|:.|..
  Fly   103 LCSMKSIRNFAAGFKREQNKLHILINNAGIMDCPKMLTEDGFEMQ--IGVNHMGHFLLTLLLLDV 165

  Fly   176 MKELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMELDLE---NQKDIHVTTVLPSF 237
            :|......:|.:||:|..|.                  |..|.:|:.|   ::|..:..:.|.:.
  Fly   166 LKSSAPSRVVVLSSIAHRFG------------------RIKRDDLNSEKSYDRKMAYCQSKLANV 212

  Fly   238 LRTNSDVTQLTHT-IGFGDVYPLFTGEEVAQRIVAGMVRGEAEITVPGMACLLYRVILILPADWQ 301
            |.|.....:|:.| :....::|             |:|..|.....|.:.. .:..:||.|..| 
  Fly   213 LFTRELAKRLSGTGVTVNALHP-------------GVVNTELFRNTPFLGS-WFGKLLIAPIIW- 262

  Fly   302 DRIILLFSRN 311
              |.:..:||
  Fly   263 --IFIKTARN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 47/196 (24%)
NADB_Rossmann 54..297 CDD:304358 57/252 (23%)
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 63/270 (23%)
NADB_Rossmann 43..317 CDD:304358 63/270 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447579
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.