DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and CG30491

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001260784.1 Gene:CG30491 / 35704 FlyBaseID:FBgn0050491 Length:331 Species:Drosophila melanogaster


Alignment Length:225 Identity:55/225 - (24%)
Similarity:96/225 - (42%) Gaps:22/225 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVKQIQDIYKVRAK---AYKANVTN 113
            |:|.:||||..|:|:....|:||:|..:.:...|:...|:..::|  :.:.:.|   ..:.::.:
  Fly    45 GKVFIVTGANTGIGKETVREIAKRGGTVYMACRNLKKCEEAREEI--VLETKNKYVYCRQCDLAS 107

  Fly   114 YDDLVELNSKVVEEMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTKLVFLPKMKE 178
            .:.:....:....|...:.||:||||||........|  .::|.:.||...||....:.|..:|:
  Fly   108 QESIRHFVAAFKREQEHLHVLINNAGVMRCPRSLTSD--GIELQLGVNHMGHFLLTNLLLDLLKK 170

  Fly   179 LRKGFIVTISSLA------GVFPLPYSATYTTTKSGALAHMRTLRMELDLENQKDIHVTTVLPSF 237
            .....||.:||||      ....|....:|...|  |.:..:...:....|..|.:..|.|..:.
  Fly   171 SSPSRIVNVSSLAHTRGEINTGDLNSDKSYDEGK--AYSQSKLANVLFTRELAKRLEGTNVTANA 233

  Fly   238 LRTNSDVTQLTHTIGFGD-------VYPLF 260
            |......|::...:||.:       |.|||
  Fly   234 LHPGVVDTEIIRHMGFFNNFFAGLFVKPLF 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 47/196 (24%)
NADB_Rossmann 54..297 CDD:304358 54/223 (24%)
CG30491NP_001260784.1 PRK06197 43..323 CDD:235737 55/225 (24%)
NADB_Rossmann 45..319 CDD:304358 55/225 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447576
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.