DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and dhs-6

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001021972.1 Gene:dhs-6 / 3565470 WormBaseID:WBGene00000970 Length:418 Species:Caenorhabditis elegans


Alignment Length:180 Identity:47/180 - (26%)
Similarity:73/180 - (40%) Gaps:38/180 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINV-----------SGAEDTV----KQIQDIYK 101
            |...::|||..|:|:.|:|:|||.|.:|.|.....           |.||:..    |.:..|..
 Worm     9 GRTVLITGASRGIGKEIALKLAKDGANIVVAAKTATAHPKLPGTIYSAAEEIEKAGGKALPCIVD 73

  Fly   102 VRAKA-YKANVTNYDDLVELNSKVVEEMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSH 165
            ||.:| .||:|          .:.|::.|.:.:|:|||..:...:..|.:.....||.::|....
 Worm    74 VRDEASVKASV----------EEAVKKFGGIDILINNASAISLTDTENTEMKRYDLMHSINTRGT 128

  Fly   166 FWTKLVFLPKMKELRKGFIVTISSLAGVFPL-------PYSATYTTTKSG 208
            |......||.:|..:...::.||.     ||       .....||..|.|
 Worm   129 FLMTKTCLPYLKSGKNPHVLNISP-----PLLMETRWFANHVAYTMAKYG 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 46/179 (26%)
NADB_Rossmann 54..297 CDD:304358 46/178 (26%)
dhs-6NP_001021972.1 PRK08278 9..275 CDD:181349 47/180 (26%)
SCP2 319..411 CDD:376720
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S1809
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.