DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and CG9265

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001260655.1 Gene:CG9265 / 35369 FlyBaseID:FBgn0032910 Length:399 Species:Drosophila melanogaster


Alignment Length:269 Identity:77/269 - (28%)
Similarity:139/269 - (51%) Gaps:21/269 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LVALLGRLIAKLCWCS---APKSIAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAED 91
            ::..:|.::..|.:.:   ..|.:..::|::||.|:||||.::..|.|.|..:.:.|||..|..:
  Fly    61 IICCIGYILQDLYYIAFGYPEKELNTDIALITGGGNGLGRLLAERLGKMGTKVVIWDINKKGIAE 125

  Fly    92 TVKQIQDI--YKVRAKAYKANVTNYDDLVELNSKVVEEMGPVTVLVNNAGVMMHRNMFNPDPADV 154
            ||:.:::.  |   .|.|..:::..:::.:....:.:|:|.:|:|:|||||:...::.:.....:
  Fly   126 TVQIVEEAGGY---CKGYVVDISKKEEVYKAADVIRDEVGDITLLINNAGVVSGLHLLDTPDHLI 187

  Fly   155 QLMINVNLTSHFWTKLVFLPKMKELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRME 219
            :...|||:.:||||...|||||.|..:|.|.||:||||...:.....|..:|..|:.....||:|
  Fly   188 ERSFNVNVMAHFWTTKAFLPKMIENDRGHIATIASLAGHVGISKLVDYCASKFAAVGFDEALRLE 252

  Fly   220 LDLENQKDIHVTTVLPSFLRTNSDVTQLTHTIGFGDV----YPLFTGEEVAQRIVAGMVRGEAEI 280
            |::....:|..|.:.|.|::.         |..|.||    .|.....:||.|::|.:.:.|...
  Fly   253 LEVLGHTNIRTTCICPFFIQA---------TGMFDDVNARWVPTLNPNDVADRVIAAIRKNEKLA 308

  Fly   281 TVPGMACLL 289
            .:||...:|
  Fly   309 VIPGFLKVL 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 61/189 (32%)
NADB_Rossmann 54..297 CDD:304358 74/242 (31%)
CG9265NP_001260655.1 fabG 82..299 CDD:235546 70/228 (31%)
17beta-HSDXI-like_SDR_c 88..328 CDD:187598 74/242 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447541
Domainoid 1 1.000 91 1.000 Domainoid score I1741
eggNOG 1 0.900 - - E2759_KOG1201
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 1 1.000 - - mtm9177
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.850

Return to query results.
Submit another query.