DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and Wwox

DIOPT Version :10

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_609171.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster


Alignment Length:130 Identity:39/130 - (30%)
Similarity:59/130 - (45%) Gaps:13/130 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KSIAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVKQI-QDIYKVRAKAYKANV 111
            |.:.|..|::|||..|:|...:..||..||.|.....|.|.||..:::| |:....|::...|.:
  Fly   117 KDLHGRTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAAL 181

  Fly   112 TNYDDLVELNS--KVVEE----MGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTKL 170
                ||..|.|  :.|||    :..:..|:.||||.........|  .::....|:..|||:..|
  Fly   182 ----DLSSLRSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVD--GLETTFQVSHLSHFYLTL 240

  Fly   171  170
              Fly   241  240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 YqjQ 49..305 CDD:440069 38/129 (29%)
WwoxNP_609171.1 WW 13..43 CDD:197736
human_WWOX_like_SDR_c-like 121..402 CDD:187669 38/126 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.