DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and CG31810

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_724023.1 Gene:CG31810 / 318955 FlyBaseID:FBgn0051810 Length:324 Species:Drosophila melanogaster


Alignment Length:340 Identity:89/340 - (26%)
Similarity:140/340 - (41%) Gaps:64/340 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LQAI---IALIGLAAITPLLI-----LVALLGRLIAKLCWCSAPKSIA---GEVAVVTGAGHGLG 65
            ||.|   |.::|..:|...|.     |.:::..::......:.||::|   |..||||||..|:|
  Fly     5 LQVISTGIYIVGSLSIVAYLYENLKSLFSIIKSVVEPFFRPNLPKTLAEKFGNWAVVTGATDGIG 69

  Fly    66 RAISLELAKKGCHIAVVDINVSGAEDTVKQIQDIYKVRAKAYKANVTNYDDLVELNSKVVEEMG- 129
            :..:.|||::|.::.:|............:|...|.|:.|..   |.::....|:.:.:.:|:. 
  Fly    70 KEYARELARQGLNLVLVSRKEEKLIAVTNEIGSQYNVKIKWI---VADFAKGREVYAHIEKELNG 131

  Fly   130 -PVTVLVNNAGVMMHRNMFNPDPADVQ----------LMINVNLTSHFWTKLVFLPKMKELRKGF 183
             .|.:||||.|. :|      ||..:.          |.:||...:....|:  ||:|...|||.
  Fly   132 IEVGILVNNVGT-IH------DPESLDKVSEDMLWDLLTVNVGSVTMLTRKI--LPQMISRRKGA 187

  Fly   184 IVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMELDLENQKDIHVTTVLPSFLRTN----SDV 244
            ||.:.|.:.:.|.|....|..||.......:.|..|:...|   |||..|:|:|:.||    ||.
  Fly   188 IVNLGSSSELQPHPNLTAYAATKKFVTHFTKGLEYEVAEHN---IHVQLVMPAFVATNMNSYSDK 249

  Fly   245 TQLTHTIGFGDVY-----PLFTGEEVAQRIVAGMVRGEAEITVPGMACLLYRVILILPADWQDRI 304
            .:....: |.:.|     .:||         .|.........|.|   |.|..:.:.|.|    |
  Fly   250 VRQGGLL-FPNAYSYARSAVFT---------LGKTSETNGFWVHG---LQYAFMKLAPMD----I 297

  Fly   305 ILLFSRNKFKKLRDE 319
            ...|....||::|.|
  Fly   298 RTYFGYQLFKRMRIE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 56/199 (28%)
NADB_Rossmann 54..297 CDD:304358 69/263 (26%)
CG31810NP_724023.1 PLN02780 12..310 CDD:166421 84/329 (26%)
17beta-HSD1_like_SDR_c 56..297 CDD:187614 72/272 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447559
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.