DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and CG3603

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001259199.1 Gene:CG3603 / 31289 FlyBaseID:FBgn0029648 Length:249 Species:Drosophila melanogaster


Alignment Length:238 Identity:66/238 - (27%)
Similarity:104/238 - (43%) Gaps:28/238 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 IAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVKQIQDIYKVRAKAYKANVTNY 114
            :||:||:|||||.|:|||....||:.|..:..||.|:..|::||   |::...|:.|.:.:|::.
  Fly     6 LAGKVALVTGAGSGIGRATCRLLARDGAKVIAVDRNLKAAQETV---QELGSERSAALEVDVSSA 67

  Fly   115 DDLVELNSKVVE-----EMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTKLVFLP 174
            .   .:...|.|     :..| |::||:||:.....:......|...:..|||...|.....:..
  Fly    68 Q---SVQFSVAEALKKFQQAP-TIVVNSAGITRDGYLLKMPERDYDDVYGVNLKGTFLVTQAYAK 128

  Fly   175 KM--KELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMELDLENQKDIHVTTVLPSF 237
            .|  ::|..|.||.:||:.........|.|..||:|.::.......|.   .:..|.|..:||.:
  Fly   129 AMIEQKLENGTIVNLSSIVAKMNNVGQANYAATKAGVISFTEVASKEF---GKFGIRVNCILPGY 190

  Fly   238 LRTNSDVTQLTHTIGFGDVYPLFTGEEVAQRIVAGMVRGEAEI 280
            :.|....           |.|....:||.||...|.:....||
  Fly   191 IDTPMVA-----------VVPDSVKQEVVQRCPLGRLGQPEEI 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 54/194 (28%)
NADB_Rossmann 54..297 CDD:304358 64/234 (27%)
CG3603NP_001259199.1 fabG 6..248 CDD:235546 66/238 (28%)
BKR_SDR_c 9..248 CDD:187594 64/235 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447589
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.