DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and Hsd17b13

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_932147.2 Gene:Hsd17b13 / 243168 MGIID:2140804 Length:304 Species:Mus musculus


Alignment Length:236 Identity:69/236 - (29%)
Similarity:118/236 - (50%) Gaps:7/236 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KSIAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVKQIQDIYKVRAKAYKANVT 112
            ||:.|:..::||||||:||..:.|.||:...:.:.|||..|.|:|..:.:.:..| ...:..:.:
Mouse    32 KSVTGQTVLITGAGHGIGRLTAYEFAKQKSRLVLWDINKRGVEETADKCRKLGAV-VHVFVVDCS 95

  Fly   113 NYDDLVELNSKVVEEMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTKLVFLPKMK 177
            |..::.....:|..|:|.|.::|||||.:...::.:....::.....||:..|||.....||.|.
Mouse    96 NRAEIYNSVDQVKREVGDVEIVVNNAGAIYPADLLSAKDEEITKTFEVNILGHFWIIKALLPSML 160

  Fly   178 ELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMELDLENQKDIHVTTVLPSFLRTNS 242
            ....|.|||::|:.|...:||...|.::|..|:...|.|..|||...:..|..:.:.|.|:.|..
Mouse   161 RRNSGHIVTVASVCGHGVIPYLIPYCSSKFAAVGFHRALTAELDTLGKTGIQTSCLCPVFVNTGF 225

  Fly   243 DVTQLTHTIGFGDVYPLFTGEEVAQRIVAGMVRGEAEITVP 283
            .....|.      ::|:...||||:.::.|::..:..|.||
Mouse   226 TKNPSTR------LWPVLEPEEVARSLINGILTNKKMIFVP 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 55/187 (29%)
NADB_Rossmann 54..297 CDD:304358 66/230 (29%)
Hsd17b13NP_932147.2 adh_short 37..228 CDD:278532 56/191 (29%)
17beta-HSDXI-like_SDR_c 38..269 CDD:187598 66/230 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 276..304
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.