DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and Sdr16c6

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001074179.1 Gene:Sdr16c6 / 242286 MGIID:2685269 Length:316 Species:Mus musculus


Alignment Length:257 Identity:79/257 - (30%)
Similarity:136/257 - (52%) Gaps:8/257 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LVALLGRLIAKLCWCSAPKSIAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVK 94
            |.:|:.::|.|     ..|.::||:.::||||.||||.:::..|..|..:.:.|||..|..:|.:
Mouse    19 LESLVFKVIPK-----RKKDVSGEIVLITGAGSGLGRLLAIHFASHGATLVLWDINQEGNMETCR 78

  Fly    95 QIQDIYKVRAKAYKANVTNYDDLVELNSKVVEEMGPVTVLVNNAGVMMHRNMFNPDPADVQLMIN 159
            .::....|:..|||.:.::..::..:..:|.||:|.||:|:|||||:..::..|.....|:....
Mouse    79 LVKQKGDVKVFAYKCDCSSRIEVYRVADQVKEEVGDVTILINNAGVVTGKSFLNTPDHLVEKSFL 143

  Fly   160 VNLTSHFWTKLVFLPKMKELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMELDLEN 224
            ||..|||||...|||.|.:...|.:|.|||:||:..:...:.|:::|..|.....:|.:||.:..
Mouse   144 VNAISHFWTCKAFLPAMVKANHGHLVCISSIAGLVGINGLSDYSSSKFAAFGFAESLFLELTMIM 208

  Fly   225 QKDIHVTTVLPSFLRTNSDVTQLTHTIGFGDVYPLFTGEEVAQRIVAGMVRGEAEITVPGMA 286
            :..:..|.|.|.|::|.......|.   :..:.||...|.|||:|...::..:..:.:|..|
Mouse   209 KTKVKSTIVCPYFIKTGMFEGCTTK---YPLLLPLLEQEYVAQKIFNAILEEQVYLIIPKFA 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 62/187 (33%)
NADB_Rossmann 54..297 CDD:304358 72/233 (31%)
Sdr16c6NP_001074179.1 adh_short 37..227 CDD:278532 63/189 (33%)
17beta-HSDXI-like_SDR_c 38..276 CDD:187598 72/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.