DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and Dhrs3

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_035433.1 Gene:Dhrs3 / 20148 MGIID:1315215 Length:302 Species:Mus musculus


Alignment Length:285 Identity:79/285 - (27%)
Similarity:149/285 - (52%) Gaps:18/285 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 IGLAAITPL----LILVALLGRLI-AKLCWCSAPKSIAGEVAVVTGAGHGLGRAISLELAKKGCH 78
            :|...:.||    |:..|.:|.:: .||      :.::.|..::||.|.|:||.::.|.|::|..
Mouse     6 LGALVVFPLQMIYLVTKAAVGMVLPPKL------RDLSRESVLITGGGRGIGRHLAREFAERGAR 64

  Fly    79 -IAVVDINVSGAEDTVKQIQDIYKVRAKAYKANVTNYDDLVELNSKVVEEMGPVTVLVNNAGVMM 142
             |.:........::|.::|:.: ......:..:|.|.:::.::...|.|::|.:|:|||||.|:.
Mouse    65 KIVLWGRTEKCLKETTEEIRQM-GTECHYFICDVGNREEVYQMAKAVREKVGDITILVNNAAVVH 128

  Fly   143 HRNMFNPDPADVQLMINVNLTSHFWTKLVFLPKMKELRKGFIVTISSLAGVFPLPYSATYTTTKS 207
            .:::.:.|...:....:||....|||...|||:|.||:.|.||.::|:..:..:|.:..|.|:|:
Mouse   129 GKSLMDSDDDALLKSQHVNTLGQFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKA 193

  Fly   208 GALAHMRTLRMELDLENQKDIHVTTVLPSFLRTNSDVTQLTHTIGFGDVYPLFTGEEVAQRIVAG 272
            .|.|.|.:|  .|.|.:...:..|||||  ..|::::.| ...:.|.:::|....|.||:|.|..
Mouse   194 SAFAFMESL--TLGLLDCPGVSATTVLP--FHTSTEMFQ-GMRVRFPNLFPPLKPETVARRTVDA 253

  Fly   273 MVRGEAEITVPGMACLLYRVILILP 297
            :.:.:|.:.:|....:|..:..|||
Mouse   254 VQQNQALLLLPWTMNILIILKSILP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 56/188 (30%)
NADB_Rossmann 54..297 CDD:304358 68/243 (28%)
Dhrs3NP_035433.1 PRK09072 35..288 CDD:236372 71/250 (28%)
17beta-HSDXI-like_SDR_c 53..281 CDD:187598 64/232 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.