DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and SDR16C5

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001304978.1 Gene:SDR16C5 / 195814 HGNCID:30311 Length:318 Species:Homo sapiens


Alignment Length:271 Identity:80/271 - (29%)
Similarity:141/271 - (52%) Gaps:19/271 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 ILVALLGRLIAKLCWCSAPKSIAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTV 93
            :|.|::..|:.|     ..|::|||:.::||||.||||.::|:.|:.|..:.:.|||..|.|:|.
Human    22 LLEAMIFALLPK-----PRKNVAGEIVLITGAGSGLGRLLALQFARLGSVLVLWDINKEGNEETC 81

  Fly    94 KQIQDIYKVRAKAYKANVTNYDDLVELNSKVVEEMGPVTVLVNNAGVMMHRNMFN-PDPADVQLM 157
            |..::....|..||..:.:..:.:..:..:|.:|:|.|::|:||||::..:...: ||    :||
Human    82 KMAREAGATRVHAYTCDCSQKEGVYRVADQVKKEVGDVSILINNAGIVTGKKFLDCPD----ELM 142

  Fly   158 ---INVNLTSHFWTKLVFLPKMKELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRME 219
               .:||..:|.||...|||.|.....|.:|.|||.||:..:...|.|..:|..|.....::.:|
Human   143 EKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCISSSAGLSGVNGLADYCASKFAAFGFAESVFVE 207

  Fly   220 LDLENQKDIHVTTVLPSFLRTNSDVTQLTHTIGFGDVYPLFTGEEVAQRIVAGMVRGEAEITVPG 284
            ..::.||.|..|.|.|.|::|....   ..|.|...:.|:...:...::||..:::.:..:.:|.
Human   208 TFVQKQKGIKTTIVCPFFIKTGMFE---GCTTGCPSLLPILEPKYAVEKIVEAILQEKMYLYMPK 269

  Fly   285 MACLLYRVILI 295
               |||.::.:
Human   270 ---LLYFMMFL 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 63/191 (33%)
NADB_Rossmann 54..297 CDD:304358 72/246 (29%)
SDR16C5NP_001304978.1 adh_short 41..231 CDD:278532 64/193 (33%)
17beta-HSDXI-like_SDR_c 42..280 CDD:187598 72/246 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.