DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and dhs-29

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_509294.1 Gene:dhs-29 / 181027 WormBaseID:WBGene00000992 Length:427 Species:Caenorhabditis elegans


Alignment Length:243 Identity:65/243 - (26%)
Similarity:123/243 - (50%) Gaps:5/243 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 KSIAGEVAVVTGAGHGLGRAISLELAKKGCHIAVVDINVSGAEDTVKQIQDIYKVRAKAYKANVT 112
            ||:.|:..::||.|.|||||::|:.||:...:|::|:|..|..:|||.|.....: ||.:..:::
 Worm    37 KSVQGQTVIITGGGSGLGRAMALDFAKRKAKVAIIDVNKEGGLETVKTIAAEGNM-AKFWYCDIS 100

  Fly   113 NYDDLVELNSKVVEEMGPVTVLVNNAGVMMHRNMFNPDPADVQLMINVNLTSHFWTKLVFLPKMK 177
            :.|::.:...::.:..|.|.:::.||.::...:........::..::||:.....|...|||||:
 Worm   101 DVDNMKKTAKEIEDTFGDVNIVICNAAILSFTSFMEISDELLRKCLDVNIFGTINTIRAFLPKME 165

  Fly   178 ELRKGFIVTISSLAGVFPLPYSATYTTTKSGALAHMRTLRMELDLENQKDIHVTTVLPSFLRTNS 242
            ....|.||.:.|:||........:|.|:|......|.:|:|||.....:.|..||:.|.|.||..
 Worm   166 TKNDGHIVCVCSIAGWSGETMGLSYCTSKFAVRGAMESLQMELRDRGLEGIKTTTLYPYFARTPM 230

  Fly   243 DV-TQLTHTIGFGDVYPLFTGEEVAQRIVAGMVRGEAEITVPGMACLL 289
            .: ..:..|..:   :|..:....::|:|..:::.:....||....|:
 Worm   231 ILENNMRPTCTW---FPFMSIRSCSKRMVDSILKEKVHAFVPSYITLI 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 54/187 (29%)
NADB_Rossmann 54..297 CDD:304358 62/237 (26%)
dhs-29NP_509294.1 adh_short 42..230 CDD:278532 55/188 (29%)
NADB_Rossmann 43..281 CDD:304358 62/237 (26%)
DUF4499 322..416 CDD:291595
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.