DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13833 and dhs-4

DIOPT Version :9

Sequence 1:NP_651111.1 Gene:CG13833 / 42718 FlyBaseID:FBgn0039040 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_492563.1 Gene:dhs-4 / 172810 WormBaseID:WBGene00000968 Length:305 Species:Caenorhabditis elegans


Alignment Length:301 Identity:82/301 - (27%)
Similarity:153/301 - (50%) Gaps:16/301 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LQAIIALIGLAAITPLLILV--ALLGRLIAKLCWCSAPKSIAGEVAVVTGAGHGLGRAISLELAK 74
            |:.:|.|..| .|..|:.|:  ||...|:.|       |.:..:..::||||:|||:.::.:.|.
 Worm     6 LEIVILLFNL-LIQNLISLIKYALPYSLLPK-------KDLYRKKVLITGAGNGLGKLLAQKFAA 62

  Fly    75 KGCHIAVVDINVSGAEDTVKQIQDIYKVRAKAYKANVTNYDDLVELNSKVVEEMGPVTVLVNNAG 139
            :|..:.:.|||:...::...:|:. .:..|.:|:.|:.:...:.::..:|:.::|.|.:||||||
 Worm    63 RGATLILWDINLQSVDELKNEIRG-NQGEAHSYEVNLCDPGKIAQVGQQVINDIGKVDILVNNAG 126

  Fly   140 VMMHRNMFNPDPADVQLMINVNLTSHFWTKLVFLPKMKELRKGFIVTISSLAGVFPLPYSATYTT 204
            :...:.:.:....::....:||:.:||:|...|||.|.:...|.||||:|.||.......|.|::
 Worm   127 IATAKMILDSSENEINRSFDVNVKAHFYTVQQFLPAMLKDNNGHIVTIASAAGKMGSSGLADYSS 191

  Fly   205 TKSGALAHMRTLRMELDLENQKD-IHVTTVLPSFLRTNS-DVTQLTHTIGFGDVYPLFTGEEVAQ 267
            ||..|:....:|..|: :|::|: :..|.|.|.::.|:. |.|..  ...|..::|:...:.|.|
 Worm   192 TKHAAVGFHDSLVAEI-MESEKNGVKTTLVCPYYVHTSMFDATGA--ATRFPWIFPILDTDYVVQ 253

  Fly   268 RIVAGMVRGEAEITVPGMACLLYRVILILPADWQDRIILLF 308
            :|...:...:..:..|....|::..|.|||...|..:...|
 Worm   254 KIFEAIETEQEFLVTPRAFYLVFAGIQILPYKAQAMVAQFF 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13833NP_651111.1 adh_short 53..241 CDD:278532 54/188 (29%)
NADB_Rossmann 54..297 CDD:304358 66/244 (27%)
dhs-4NP_492563.1 adh_short 41..235 CDD:278532 57/195 (29%)
17beta-HSDXI-like_SDR_c 43..286 CDD:187598 68/246 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1201
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG29002
OrthoDB 1 1.010 - - D1373099at2759
OrthoFinder 1 1.000 - - FOG0000227
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24322
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.